Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02152
- pan locus tag?: SAUPAN004997000
- symbol: SAOUHSC_02152
- pan gene symbol?: pmtC
- synonym:
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
- Gene ID: 3921849 NCBI
- RefSeq: YP_500642 NCBI
- BioCyc: G1I0R-2038 BioCyc
- MicrobesOnline: 1290598 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841ATGAAATTAGAACATATTACAAAAAAATACGGCTCAAATGTCGTTTTAAATGATATTGAT
TTTGACTTTGGCGATAGTAGAATTGTCGGATTAATAGGAAAAAACGGTGTTGGTAAAACA
ACCGTTATGAAAGTAATGAATGGTAATATTATTAAATTTGATGGAAAAGTAGATATTGAT
AATGCAGATAATATCGGTTTTTTAATTGAGCATCCTAAATTATATGATAATAAATCAGGA
TTGTATAACTTGAAATTATTTGCACAAGTATTAGGTAAGGGTTTTGATAAAGCATACACA
GACAAAATTATAGATGCATTTGGTATGAGACCTTATATTAAAAAGAAAGTTAAGAAATAT
TCAATGGGGATGAAGCAAAAGTTAGCAATTGCAGTATCTTTAATGAATAAACCTAAATTT
TTAATCTTGGATGAGCCTACAAATGGTATGGATCCAGATGGCTCAATTGATGTGCTGACT
ACAATTAAGTCTTTAGTAAATGAACTTGATATGAGAATTCTAATATCAAGTCATAAGTTA
GAAGATATTGAATTAATTTGTGATAGAGCTGTATTTTTAAGAGACGGACATTTTGTTCAA
GATGTAAACATGGAGGAAGGTGTTGCATCTGACACAACGATAGTTACTGTTGATCATAAA
GACTTTGATAGAACTGAAAAATATCTTGCAGAGCATTTCCAATTACAAAATGTCGACAAA
GCAGACGGACATTTAATGATCAATGCACAAAAAAATTATCAAGTTATACTAAAAGCATTA
TCTGAATTAGATATTTATCCGAAATATATTGAAACACGTAAAAGTTCATTGCGTGATACG
TACTTCAATATAAATCAAAGAGGTGATAAATAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
873
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02152
- symbol: SAOUHSC_02152
- description: ABC transporter ATP-binding protein
- length: 290
- theoretical pI: 7.76705
- theoretical MW: 32951.8
- GRAVY: -0.331034
⊟Function[edit | edit source]
- TIGRFAM: lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 158.7)and 72 moreTransport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 126.7)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 122.8)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 104.6)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 102.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 98.7)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 96.2)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 96.2)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 94.4)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 89.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 88.2)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 86.5)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 84.7)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 83.4)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 82.8)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 82.8)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 80.4)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 78)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 77)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 76.7)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 76.7)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 72.8)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 72.3)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 72.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 71)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 69.8)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 69.8)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 68.3)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 67.7)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 67.6)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 67.4)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 65.1)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 63.2)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 63.2)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 63.2)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 62)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 61.4)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 61.3)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 60.8)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 60.4)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 58.6)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 58.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 57.7)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 56.8)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 56.8)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 55.3)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 54.9)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 52.7)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 50.4)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 50.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 49.2)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 49.2)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 49.1)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 49.1)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 48.3)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 46.5)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 45.7)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 43.8)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 43.8)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 38)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 38)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 38)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 36.8)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 35.1)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 34)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 30.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 28)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 23.4)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 23.4)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 21.6)Biosynthesis of cofactors, prosthetic groups, and carriers Pantothenate and coenzyme A dephospho-CoA kinase (TIGR00152; EC 2.7.1.24; HMM-score: 16.2)Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 15.1)Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 15.1)
- TheSEED :
- ABC transporter, ATP-binding protein
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 81.6)and 13 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 42.5)AAA_22; AAA domain (PF13401; HMM-score: 17.9)AAA_23; AAA domain (PF13476; HMM-score: 17.4)AAA_15; AAA ATPase domain (PF13175; HMM-score: 17)PduV-EutP; Ethanolamine utilisation - propanediol utilisation (PF10662; HMM-score: 14.4)ArgK; ArgK protein (PF03308; HMM-score: 13.5)AAA_24; AAA domain (PF13479; HMM-score: 13.1)AAA_18; AAA domain (PF13238; HMM-score: 13)NB-ARC; NB-ARC domain (PF00931; HMM-score: 12.8)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 12.5)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 12.4)AAA_14; AAA domain (PF13173; HMM-score: 10.6)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 8.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.012898
- TAT(Tat/SPI): 0.000264
- LIPO(Sec/SPII): 0.000482
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLEHITKKYGSNVVLNDIDFDFGDSRIVGLIGKNGVGKTTVMKVMNGNIIKFDGKVDIDNADNIGFLIEHPKLYDNKSGLYNLKLFAQVLGKGFDKAYTDKIIDAFGMRPYIKKKVKKYSMGMKQKLAIAVSLMNKPKFLILDEPTNGMDPDGSIDVLTTIKSLVNELDMRILISSHKLEDIELICDRAVFLRDGHFVQDVNMEEGVASDTTIVTVDHKDFDRTEKYLAEHFQLQNVDKADGHLMINAQKNYQVILKALSELDIYPKYIETRKSSLRDTYFNINQRGDK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [2] [3]
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_02151 < SAOUHSC_02152predicted SigA promoter [4] : SAOUHSC_02151 < SAOUHSC_02152 < SAOUHSC_02153 < SAOUHSC_02154 < SAOUHSC_02155predicted SigA promoter [4] : SAOUHSC_02151 < SAOUHSC_02152 < SAOUHSC_02153 < SAOUHSC_02154 < SAOUHSC_02155 < SAOUHSC_02156
⊟Regulation[edit | edit source]
- regulator: PmtR* (repression) regulon
PmtR* (TF) important in Hypothetical ABC transporter; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [4]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
BMC Genomics: 2009, 10;291
[PubMed:19570206] [WorldCat.org] [DOI] (I e) - ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 4.0 4.1 4.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
Som S Chatterjee, Hwang-Soo Joo, Anthony C Duong, Thomas D Dieringer, Vee Y Tan, Yan Song, Elizabeth R Fischer, Gordon Y C Cheung, Min Li, Michael Otto
Essential Staphylococcus aureus toxin export system.
Nat Med: 2013, 19(3);364-7
[PubMed:23396209] [WorldCat.org] [DOI] (I p)