Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02156
- pan locus tag?: SAUPAN005001000
- symbol: SAOUHSC_02156
- pan gene symbol?: —
- synonym: JSNZ_001970
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02156
- symbol: SAOUHSC_02156
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2026970..2027146
- length: 177
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921853 NCBI
- RefSeq: YP_500646 NCBI
- BioCyc: G1I0R-2042 BioCyc
- MicrobesOnline: 1290602 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121TTGAAACATCTAACAAAAATATTTGTAGTACTTGCAATTATTTTATTTATTATTGGTTAT
TATTTACAAGCAACTAATCATGAAAGCCAAGGTATAAAATTATTATTAGCAGCGATTATG
TTTATGATTTGTGCTTTTATAAGTAGAAGTAATGATCGACGTAAAAATAGTAAATAG60
120
177
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02156
- symbol: SAOUHSC_02156
- description: hypothetical protein
- length: 58
- theoretical pI: 10.7419
- theoretical MW: 6685.08
- GRAVY: 0.551724
⊟Function[edit | edit source]
- TIGRFAM: Hypothetical proteins Conserved TIGR00245 family protein (TIGR00245; HMM-score: 18.3)and 1 moreCell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides oligosaccharide repeat unit polymerase (TIGR04370; HMM-score: 13.4)
- TheSEED :
- FIG01107851: hypothetical protein
- PFAM: no clan defined DUF3169; Protein of unknown function (DUF3169) (PF11368; HMM-score: 22.5)and 17 moreABC-2 (CL0181) ABC2_membrane_5; ABC-2 family transporter protein (PF13346; HMM-score: 17.4)CopD_like (CL0430) DUF1516; Protein of unknown function (DUF1516) (PF07457; HMM-score: 16.8)no clan defined YesK; YesK-like protein (PF14150; HMM-score: 16.5)TSPAN_4TM-like (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 15.7)Hypoth_1 (CL0447) DUF3784; Domain of unknown function (DUF3784) (PF12650; HMM-score: 15.5)Acyl_transf_3 (CL0316) Acyl_transf_3; Acyltransferase domain (PF01757; HMM-score: 15.1)no clan defined DUF7649; Domain of unknown function (DUF7649) (PF24661; HMM-score: 15.1)DUF131; Protein of unknown function DUF131 (PF01998; HMM-score: 14)RseC_MucC; Positive regulator of sigma(E), RseC/MucC (PF04246; HMM-score: 13.8)Cyt_c_ox_IV; Cytochrome c oxidase subunit IV (PF12270; HMM-score: 13.8)MFS (CL0015) MFS_1; Major Facilitator Superfamily (PF07690; HMM-score: 13.3)no clan defined FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 12.4)DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 12.3)ETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 11.9)NVEALA; NVEALA protein (PF14055; HMM-score: 10.8)DUF6903; Family of unknown function (DUF6903) (PF21844; HMM-score: 8.8)SPC12; Microsomal signal peptidase 12 kDa subunit (SPC12) (PF06645; HMM-score: 8.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9781
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0218
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.082012
- TAT(Tat/SPI): 0.001183
- LIPO(Sec/SPII): 0.06066
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKHLTKIFVVLAIILFIIGYYLQATNHESQGIKLLLAAIMFMICAFISRSNDRRKNSK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- predicted SigA promoter [1] : SAOUHSC_02151 < SAOUHSC_02152 < SAOUHSC_02153 < SAOUHSC_02154 < SAOUHSC_02155 < SAOUHSC_02156
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [1]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
