From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SAS057 [new locus tag: SA_RS10040 ]
  • pan locus tag?: SAUPAN005001000
  • symbol: SAS057
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAS057 [new locus tag: SA_RS10040 ]
  • symbol: SAS057
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2000746..2000922
  • length: 177
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    TTGAAACATCTAACAAAAATATTTGTAGTACTTGCAATTATTTTATTTATTATTGGTTAT
    TATTTACAAGCAACTAATCATGAAAGCCAAGGTATAAAATTATTATTAGCAGCGATTATG
    TTTATGATTTGTGCTTTTATAAGTAGAAGTAATGATCGACGTAAAAATAGTAAATAG
    60
    120
    177

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAS057 [new locus tag: SA_RS10040 ]
  • symbol: SAS057
  • description: hypothetical protein
  • length: 58
  • theoretical pI: 10.7419
  • theoretical MW: 6685.08
  • GRAVY: 0.551724

⊟Function[edit | edit source]

  • TIGRFAM:
    Hypothetical proteins Conserved TIGR00245 family protein (TIGR00245; HMM-score: 18.3)
    and 1 more
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides oligosaccharide repeat unit polymerase (TIGR04370; HMM-score: 13.4)
  • TheSEED  :
    • FIG01107851: hypothetical protein
  • PFAM:
    no clan defined DUF3169; Protein of unknown function (DUF3169) (PF11368; HMM-score: 22.9)
    DUF1516; Protein of unknown function (DUF1516) (PF07457; HMM-score: 19.4)
    and 12 more
    YesK; YesK-like protein (PF14150; HMM-score: 16.8)
    ABC-2 (CL0181) ABC2_membrane_5; ABC-2 family transporter protein (PF13346; HMM-score: 16.5)
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 15.9)
    no clan defined Cyt_c_ox_IV; Cytochrome c oxidase subunit IV (PF12270; HMM-score: 14.2)
    DUF131; Protein of unknown function DUF131 (PF01998; HMM-score: 14)
    P12; Virus attachment protein p12 family (PF12669; HMM-score: 13.6)
    SirB; Invasion gene expression up-regulator, SirB (PF04247; HMM-score: 13.5)
    RseC_MucC; Positive regulator of sigma(E), RseC/MucC (PF04246; HMM-score: 13.2)
    ETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 13.2)
    NVEALA; NVEALA protein (PF14055; HMM-score: 12.7)
    E1-E2_ATPase; E1-E2 ATPase (PF00122; HMM-score: 10.2)
    SPC12; Microsomal signal peptidase 12 kDa subunit (SPC12) (PF06645; HMM-score: 9.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.082012
    • TAT(Tat/SPI): 0.001183
    • LIPO(Sec/SPII): 0.06066
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKHLTKIFVVLAIILFIIGYYLQATNHESQGIKLLLAAIMFMICAFISRSNDRRKNSK

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAS057&oldid=85982"