From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1374 [new locus tag: SACOL_RS06995 ]
  • pan locus tag?: SAUPAN003714000
  • symbol: lexA
  • pan gene symbol?: lexA
  • synonym:
  • product: LexA repressor

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1374 [new locus tag: SACOL_RS06995 ]
  • symbol: lexA
  • product: LexA repressor
  • replicon: chromosome
  • strand: -
  • coordinates: 1378832..1379455
  • length: 624
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAGAGAATTAACAAAACGACAAAGCGAAATATATAACTATATTAAACAAGTTGTTCAA
    ACGAAAGGTTATCCGCCTAGTGTTCGCGAAATTGGTGAAGCAGTTGGCTTAGCATCCAGT
    TCAACTGTTCATGGTCACCTTTCACGTCTTGAAGAAAAAGGCTATATAAGAAGAGATCCA
    ACGAAACCACGTGCTATAGAAATTGTAAGTGATCAAACAAATGATAATATTAATATGGAA
    GAAACGATTCATGTGCCAGTTATTGGTAAAGTCACAGCAGGTGTTCCTATTACCGCAGTA
    GAAAATATTGAAGAATATTTTCCATTACCTGAACACTTAACATCGACACACAATAGCGAC
    ATATTCATATTAAACGTCGTAGGCGACAGTATGATTGAGGCTGGTATATTAGACGGAGAC
    AAAGTAATTGTTCGCAGTCAAACCATAGCAGAAAATGGAGACATTATTGTTGCTATGACT
    GAGGAAGATGAAGCAACTGTCAAACGCTTCTATAAAGAAAAAAATCGTTATCGATTACAA
    CCTGAAAATAGTACAATGGAGCCAATTTACCTAGACAATGTTGCTGTAATTGGGAAAGTA
    ATTGGTTTGTACCGCGAAATGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    624

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1374 [new locus tag: SACOL_RS06995 ]
  • symbol: LexA
  • description: LexA repressor
  • length: 207
  • theoretical pI: 4.88134
  • theoretical MW: 23301.3
  • GRAVY: -0.357971

Function[edit | edit source]

  • reaction:
    EC 3.4.21.88?  ExPASy
    Repressor LexA Hydrolysis of Ala-|-Gly bond in repressor LexA
  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 250.9)
    Signal transduction Regulatory functions DNA interactions repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 250.9)
    and 1 more
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15.4)
  • TheSEED  :
    • SOS-response repressor and protease LexA (EC 3.4.21.88)
    DNA Metabolism DNA repair DNA repair, bacterial  SOS-response repressor and protease LexA (EC 3.4.21.88)
    and 1 more
    DNA Metabolism DNA repair DNA repair, bacterial UmuCD system  SOS-response repressor and protease LexA (EC 3.4.21.88)
  • PFAM:
    Peptidase_SF (CL0299) Peptidase_S24; Peptidase S24-like (PF00717; HMM-score: 123.2)
    and 17 more
    HTH (CL0123) LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 98.1)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 25)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 23.6)
    MarR_2; MarR family (PF12802; HMM-score: 22.7)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 17.5)
    MarR; MarR family (PF01047; HMM-score: 17.1)
    HTH_11; HTH domain (PF08279; HMM-score: 14.9)
    no clan defined KfrA_N; Plasmid replication region DNA-binding N-term (PF11740; HMM-score: 14.9)
    HTH (CL0123) HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 14.8)
    Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 14.5)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 14.1)
    DUF7342; Family of unknown function (DUF7342) (PF24033; HMM-score: 13.4)
    HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 13.2)
    HTH_TbsP_C; Transcriptional regulator TbsP-like, C-terminal HTH domain (PF23336; HMM-score: 13.2)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 12.9)
    Xre-like-HTH; Antitoxin Xre-like helix-turn-helix domain (PF20432; HMM-score: 11.9)
    no clan defined CobN-Mg_chel; CobN/Magnesium Chelatase (PF02514; HMM-score: 11.7)

Structure, modifications & cofactors[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9989
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0007
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011079
    • TAT(Tat/SPI): 0.002754
    • LIPO(Sec/SPII): 0.001561
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRELTKRQSEIYNYIKQVVQTKGYPPSVREIGEAVGLASSSTVHGHLSRLEEKGYIRRDPTKPRAIEIVSDQTNDNINMEETIHVPVIGKVTAGVPITAVENIEEYFPLPEHLTSTHNSDIFILNVVGDSMIEAGILDGDKVIVRSQTIAENGDIIVAMTEEDEATVKRFYKEKNRYRLQPENSTMEPIYLDNVAVIGKVIGLYREM

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 344 [4]
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: LexA (repression) regulon
    LexA(TF)important in SOS response; RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 3.42 h [5]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

H De Lencastre, S W Wu, M G Pinho, A M Ludovice, S Filipe, S Gardete, R Sobral, S Gill, M Chung, A Tomasz
Antibiotic resistance as a stress response: complete sequencing of a large number of chromosomal loci in Staphylococcus aureus strain COL that impact on the expression of resistance to methicillin.
Microb Drug Resist: 1999, 5(3);163-75
[PubMed:10566865] [WorldCat.org] [DOI] (P p)