Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1374 [new locus tag: SACOL_RS06995 ]
- pan locus tag?: SAUPAN003714000
- symbol: lexA
- pan gene symbol?: lexA
- synonym:
- product: LexA repressor
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1374 [new locus tag: SACOL_RS06995 ]
- symbol: lexA
- product: LexA repressor
- replicon: chromosome
- strand: -
- coordinates: 1378832..1379455
- length: 624
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237666 NCBI
- RefSeq: YP_186227 NCBI
- BioCyc: see SACOL_RS06995
- MicrobesOnline: 912833 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAGAGAATTAACAAAACGACAAAGCGAAATATATAACTATATTAAACAAGTTGTTCAA
ACGAAAGGTTATCCGCCTAGTGTTCGCGAAATTGGTGAAGCAGTTGGCTTAGCATCCAGT
TCAACTGTTCATGGTCACCTTTCACGTCTTGAAGAAAAAGGCTATATAAGAAGAGATCCA
ACGAAACCACGTGCTATAGAAATTGTAAGTGATCAAACAAATGATAATATTAATATGGAA
GAAACGATTCATGTGCCAGTTATTGGTAAAGTCACAGCAGGTGTTCCTATTACCGCAGTA
GAAAATATTGAAGAATATTTTCCATTACCTGAACACTTAACATCGACACACAATAGCGAC
ATATTCATATTAAACGTCGTAGGCGACAGTATGATTGAGGCTGGTATATTAGACGGAGAC
AAAGTAATTGTTCGCAGTCAAACCATAGCAGAAAATGGAGACATTATTGTTGCTATGACT
GAGGAAGATGAAGCAACTGTCAAACGCTTCTATAAAGAAAAAAATCGTTATCGATTACAA
CCTGAAAATAGTACAATGGAGCCAATTTACCTAGACAATGTTGCTGTAATTGGGAAAGTA
ATTGGTTTGTACCGCGAAATGTAA60
120
180
240
300
360
420
480
540
600
624
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1374 [new locus tag: SACOL_RS06995 ]
- symbol: LexA
- description: LexA repressor
- length: 207
- theoretical pI: 4.88134
- theoretical MW: 23301.3
- GRAVY: -0.357971
⊟Function[edit | edit source]
- reaction: EC 3.4.21.88? ExPASyRepressor LexA Hydrolysis of Ala-|-Gly bond in repressor LexA
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 250.9)Regulatory functions DNA interactions repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 250.9)and 1 moreRegulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15.4)
- TheSEED :
- SOS-response repressor and protease LexA (EC 3.4.21.88)
DNA Metabolism DNA repair DNA repair, bacterial SOS-response repressor and protease LexA (EC 3.4.21.88)and 1 more - PFAM: Peptidase_SF (CL0299) Peptidase_S24; Peptidase S24-like (PF00717; HMM-score: 123.2)and 17 moreHTH (CL0123) LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 98.1)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 25)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 23.6)MarR_2; MarR family (PF12802; HMM-score: 22.7)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 17.5)MarR; MarR family (PF01047; HMM-score: 17.1)HTH_11; HTH domain (PF08279; HMM-score: 14.9)no clan defined KfrA_N; Plasmid replication region DNA-binding N-term (PF11740; HMM-score: 14.9)HTH (CL0123) HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 14.8)Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 14.5)Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 14.1)DUF7342; Family of unknown function (DUF7342) (PF24033; HMM-score: 13.4)HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 13.2)HTH_TbsP_C; Transcriptional regulator TbsP-like, C-terminal HTH domain (PF23336; HMM-score: 13.2)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 12.9)Xre-like-HTH; Antitoxin Xre-like helix-turn-helix domain (PF20432; HMM-score: 11.9)no clan defined CobN-Mg_chel; CobN/Magnesium Chelatase (PF02514; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- stimulus: DNA damage
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9989
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0
- Extracellular Score: 0.0007
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011079
- TAT(Tat/SPI): 0.002754
- LIPO(Sec/SPII): 0.001561
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRELTKRQSEIYNYIKQVVQTKGYPPSVREIGEAVGLASSSTVHGHLSRLEEKGYIRRDPTKPRAIEIVSDQTNDNINMEETIHVPVIGKVTAGVPITAVENIEEYFPLPEHLTSTHNSDIFILNVVGDSMIEAGILDGDKVIVRSQTIAENGDIIVAMTEEDEATVKRFYKEKNRYRLQPENSTMEPIYLDNVAVIGKVIGLYREM
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 344 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: LexA (repression) regulon
LexA (TF) important in SOS response; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 3.42 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
H De Lencastre, S W Wu, M G Pinho, A M Ludovice, S Filipe, S Gardete, R Sobral, S Gill, M Chung, A Tomasz
Antibiotic resistance as a stress response: complete sequencing of a large number of chromosomal loci in Staphylococcus aureus strain COL that impact on the expression of resistance to methicillin.
Microb Drug Resist: 1999, 5(3);163-75
[PubMed:10566865] [WorldCat.org] [DOI] (P p)