Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1301 [new locus tag: SACOL_RS06640 ]
- pan locus tag?: SAUPAN003584000
- symbol: SACOL1301
- pan gene symbol?: rodZ
- synonym:
- product: transcriptional regulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1301 [new locus tag: SACOL_RS06640 ]
- symbol: SACOL1301
- product: transcriptional regulator
- replicon: chromosome
- strand: +
- coordinates: 1317450..1317842
- length: 393
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236360 NCBI
- RefSeq: YP_186158 NCBI
- BioCyc: see SACOL_RS06640
- MicrobesOnline: 912764 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361TTGAAAACGGTCGGTGAAGCGCTAAAAGGTAGACGTGAAAGGTTAGGAATGACTTTAACA
GAATTAGAGCAACGTACTGGAATTAAACGTGAAATGCTAGTGCATATTGAAAATAATGAA
TTCGATCAACTACCGAATAAAAATTACAGCGAAGGATTTATTAGAAAATATGCAAGCGTA
GTAAATATTGAACCTAACCAATTAATTCAAGCTCATCAAGATGAAATTCCATCGAACCAA
GCCGAATGGGACGAAGTAATTACAGTTTTCAATAATAATAAAGACTTAGATTATAAGAGT
AAATCAAAAGAGCCAATACAATTATTAGTAATCATGGGTATTACAGTTTTAATAACTTTA
TTGTTATGGATCATGTTAGTTTTAATATTTTAA60
120
180
240
300
360
393
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1301 [new locus tag: SACOL_RS06640 ]
- symbol: SACOL1301
- description: transcriptional regulator
- length: 130
- theoretical pI: 5.24544
- theoretical MW: 15113.4
- GRAVY: -0.226154
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 16.1)
- TheSEED :
- Cytoskeleton protein RodZ
- PFAM: HTH (CL0123) HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 59.9)and 6 moreHTH_19; Helix-turn-helix domain (PF12844; HMM-score: 31.5)HTH_3; Helix-turn-helix (PF01381; HMM-score: 24.7)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 19.2)no clan defined COX5B; Cytochrome c oxidase subunit Vb (PF01215; HMM-score: 14.9)HTH (CL0123) Sulfolobus_pRN; Sulfolobus plasmid regulatory protein (PF05584; HMM-score: 13.5)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9938
- Cell wall & surface Score: 0
- Extracellular Score: 0.0061
- LocateP: Intracellular /TMH start AFTER 60
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: Possibly Sec-
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00614
- TAT(Tat/SPI): 0.000912
- LIPO(Sec/SPII): 0.002503
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKTVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASVVNIEPNQLIQAHQDEIPSNQAEWDEVITVFNNNKDLDYKSKSKEPIQLLVIMGITVLITLLLWIMLVLIF
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Integral membrane [1] [2] [3]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SACOL1295 > SACOL1296 > SACOL1297 > SACOL1298 > SACOL1299 > SACOL1300 > SACOL1301 > pgsA
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)