Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1448 [new locus tag: SA_RS08160 ]
- pan locus tag?: SAUPAN004218000
- symbol: SA1448
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1448 [new locus tag: SA_RS08160 ]
- symbol: SA1448
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1651966..1652634
- length: 669
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124290 NCBI
- RefSeq: NP_374733 NCBI
- BioCyc: see SA_RS08160
- MicrobesOnline: 103759 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGATAGATCAACAAACAATTTATCAATACATACAAAATGGAAAAATAGAAGAAGCGTTA
CAAGCATTGTTCGGAAATATCGAAGAAGATCCTACAATTATTGAAAATTATATTAATGCT
GGTATCGTACTTGCTGATGCGAATGAGATTGAAAAGGCAGAGCGTTTTTTCCAAAAAGCT
TTAACAATAGATCCGAAGAATGGCGTCGTATTTTATAATCTAGCAAATGTATATTATAAT
CAGCAACGTTATCAAGAAGCTATTAAATTATATCAACAAGCATTACAAACAGAGATTGAA
CAAGTTGATTGTAATTATATGATCGGTATGGCGTTTAATCAGTTAGAATCATTTAAGCTG
GCATTGCCGTATTTAATGACTGCTGCGGAACTAGATAAAGACAAAGATGCAGAAGTTCAA
TTTCAATATGGTCTTGTATTATGTCAATTAGAAATGTTTAATGAAGCCATAACTCAACTT
AAACATGTATTAACGATTGATAAAAATCATGTTGATGCAAGATACAATTTGGGCTTAGCG
TTATTTATGAAAAATGAAGATATTGATGAAGCAATAACTCATTTTAAAGAAGCTGTGACT
ATCGACCCTAAACACTTATTAAGTCAGCATGCGCTGAAAACATTCACTAAAATGAAAGAG
GAGGAGTAA60
120
180
240
300
360
420
480
540
600
660
669
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1448 [new locus tag: SA_RS08160 ]
- symbol: SA1448
- description: hypothetical protein
- length: 222
- theoretical pI: 4.37482
- theoretical MW: 25718.1
- GRAVY: -0.295946
⊟Function[edit | edit source]
- TIGRFAM: type IV pilus biogenesis/stability protein PilW (TIGR02521; HMM-score: 73.5)putative PEP-CTERM system TPR-repeat lipoprotein (TIGR02917; HMM-score: 69)type III secretion low calcium response chaperone LcrH/SycD (TIGR02552; HMM-score: 59.2)and 7 moreTransport and binding proteins Amino acids, peptides and amines mitochondrial precursor proteins import receptor (TIGR00990; HMM-score: 53.8)tol-pal system protein YbgF (TIGR02795; HMM-score: 32.7)putative peptide modification system cyclase (TIGR04510; HMM-score: 25.8)Unknown function General heme biosynthesis-associated TPR protein (TIGR00540; HMM-score: 24.5)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides adenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 23.5)pentatricopeptide repeat domain (TIGR00756; HMM-score: 22.7)poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA (TIGR03939; HMM-score: 20.4)
- TheSEED :
- TPR repeat-containing protein YrrB
- PFAM: TPR (CL0020) TPR_1; Tetratricopeptide repeat (PF00515; HMM-score: 99.5)TPR_2; Tetratricopeptide repeat (PF07719; HMM-score: 97.6)TPR_8; Tetratricopeptide repeat (PF13181; HMM-score: 93.1)TPR_11; TPR repeat (PF13414; HMM-score: 87.5)TPR_12; Tetratricopeptide repeat (PF13424; HMM-score: 79.7)and 42 moreTPR_19; Tetratricopeptide repeat (PF14559; HMM-score: 68.6)TPR_17; Tetratricopeptide repeat (PF13431; HMM-score: 66.5)TPR_14; Tetratricopeptide repeat (PF13428; HMM-score: 62.6)TPR_16; Tetratricopeptide repeat (PF13432; HMM-score: 60.4)ANAPC3; Anaphase-promoting complex, cyclosome, subunit 3 (PF12895; HMM-score: 55.4)TPR_10; Tetratricopeptide repeat (PF13374; HMM-score: 51.2)TPR_7; Tetratricopeptide repeat (PF13176; HMM-score: 47.8)TPR_CcmH_CycH; Cytochrome c-type biogenesis protein H TPR domain (PF23914; HMM-score: 44.7)TPR_6; Tetratricopeptide repeat (PF13174; HMM-score: 43.3)TPR_20; Tetratricopeptide repeat (PF14561; HMM-score: 35.1)TPR_Slam; Surface lipoprotein assembly modifier, N-terminal TPR repeats (PF24575; HMM-score: 35)T7SS_EccA1_N; T7SS, ESX-1 secretion system protein EccA1, N-terminal domain (PF21545; HMM-score: 32.9)TPR_9; Tetratricopeptide repeat (PF13371; HMM-score: 30.4)TPR-S; Tetratricopeptide Repeats-Sensor (PF20308; HMM-score: 29.3)TOM20_plant; Plant specific mitochondrial import receptor subunit TOM20 (PF06552; HMM-score: 28.6)PPR; PPR repeat (PF01535; HMM-score: 25.5)ARM_TT21_C; Tetratricopeptide repeat protein 21 C-terminal ARM domain (PF25063; HMM-score: 24.9)TPR_NPHP3; Nephrocystin-3 TPR domain (PF24885; HMM-score: 23.2)TPR_15; Tetratricopeptide repeat (PF13429; HMM-score: 22)ARM_TT21_4th; Tetratricopeptide repeat protein 21 forth ARM domain (PF25068; HMM-score: 21.4)ARM_TT21_N; Tetratricopeptide repeat protein 21 N-terminal ARM repeat (PF25062; HMM-score: 20.3)TPR_3; Tetratricopeptide repeat (PF07720; HMM-score: 19.9)ARM_TT21_5th; TT21 fifth ARM repeats domain (PF25064; HMM-score: 19.7)ARM_TT21; Tetratricopeptide repeat protein 21 ARM repeat (PF25058; HMM-score: 19.4)E_motif; E motif (PF20431; HMM-score: 17.7)MIT (CL0745) MIT; MIT (microtubule interacting and transport) domain (PF04212; HMM-score: 17.4)TPR (CL0020) PPR_2; PPR repeat family (PF13041; HMM-score: 17.2)TPR_4; Tetratricopeptide repeat (PF07721; HMM-score: 16.8)NatA_aux_su; N-terminal acetyltransferase A, auxiliary subunit (PF12569; HMM-score: 16.5)RNPP_C; RNPP family C-terminal domain (PF18768; HMM-score: 16.2)no clan defined MatP; MatP N-terminal domain (PF06303; HMM-score: 15.8)TPR (CL0020) TPR_27; Plant tetratrico peptide repeats (PF23310; HMM-score: 14.3)Hect (CL0552) HECT_2; HECT-like Ubiquitin-conjugating enzyme (E2)-binding (PF09814; HMM-score: 14)TPR (CL0020) TPR_P4H; Prolyl 4-hydroxylase peptide-substrate-binding domain (PF23558; HMM-score: 13.5)no clan defined DUF1512; Protein of unknown function (DUF1512) N-terminal domain (PF07431; HMM-score: 13.4)TPR (CL0020) Rapsyn_N; Rapsyn N-terminal myristoylation and linker region (PF10579; HMM-score: 12.7)TPR_21; Tetratricopeptide repeat-like domain (PF09976; HMM-score: 12.4)TPR_MalT; MalT-like TPR region (PF17874; HMM-score: 12.4)EAD11; Effector-associated domain 11 (PF19964; HMM-score: 12.1)Fis1_TPR_C; Fis1 C-terminal tetratricopeptide repeat (PF14853; HMM-score: 11.5)Sel1; Sel1 repeat (PF08238; HMM-score: 10.9)Clathrin; Region in Clathrin and VPS (PF00637; HMM-score: 10.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8874
- Cytoplasmic Membrane Score: 0.066
- Cell wall & surface Score: 0.0166
- Extracellular Score: 0.0299
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003148
- TAT(Tat/SPI): 0.000166
- LIPO(Sec/SPII): 0.000337
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIDQQTIYQYIQNGKIEEALQALFGNIEEDPTIIENYINAGIVLADANEIEKAERFFQKALTIDPKNGVVFYNLANVYYNQQRYQEAIKLYQQALQTEIEQVDCNYMIGMAFNQLESFKLALPYLMTAAELDKDKDAEVQFQYGLVLCQLEMFNEAITQLKHVLTIDKNHVDARYNLGLALFMKNEDIDEAITHFKEAVTIDPKHLLSQHALKTFTKMKEEE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]