From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1577 [new locus tag: SAUSA300_RS08595 ]
  • pan locus tag?: SAUPAN004218000
  • symbol: SAUSA300_1577
  • pan gene symbol?:
  • synonym:
  • product: TPR domain-containing protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1577 [new locus tag: SAUSA300_RS08595 ]
  • symbol: SAUSA300_1577
  • product: TPR domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1727508..1728176
  • length: 669
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATAGATCAACAAACAATTTATCAATACATACAAAATGGAAAAATAGAAGAAGCGTTA
    CAAGCATTGTTCGGAAATATCGAAGAAAATCCTACAATTATTGAAAATTATATTAATGCT
    GGTATCGTACTTGCTGATGCGAATGAGATTGAAAAGGCAGAGCGTTTTTTCCAAAAAGCT
    TTAACAATAGATCCGAAGAATGGCGTCGTATTTTTTAATCTAGCAAATGTATATTATAAT
    CAGCAACGTTATCAAGAAGCTATTAAATTATATCAACAAGCATTACAAACAGAGATTGAA
    CAAGTTGATTGTAATTATATGATCGGTATGGCGTTTAATCAGTTAGAATCATTTAAGCTG
    GCATTGCCGTATTTAATGACTGCTGCGGAACTAGATAAAGACAAAGATGCAGAAGTTCAA
    TTTCAATATGGTCTTGTATTATGTCAATTAGAAATGTTTAATGAAGCCATAACTCAACTT
    AAACATGTATTAACGATTGATAAAAATCATGTTGATGCAAGATACAATTTGGGCTTAGCG
    TTATTTATGAAAAATGAAGATATTGATGAAGCAATAACTCATTTTAAAGAAGCTGTGACT
    ATCGACCCTAAACACTTATTAAGTCAGCATGCGCTGAAAACATTCACTAAAATGAAAGAG
    GAGGAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    669

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1577 [new locus tag: SAUSA300_RS08595 ]
  • symbol: SAUSA300_1577
  • description: TPR domain-containing protein
  • length: 222
  • theoretical pI: 4.41965
  • theoretical MW: 25701.1
  • GRAVY: -0.277477

Function[edit | edit source]

  • TIGRFAM:
    type IV pilus biogenesis/stability protein PilW (TIGR02521; HMM-score: 72.1)
    putative PEP-CTERM system TPR-repeat lipoprotein (TIGR02917; HMM-score: 70.8)
    and 8 more
    type III secretion low calcium response chaperone LcrH/SycD (TIGR02552; HMM-score: 56.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines mitochondrial precursor proteins import receptor (TIGR00990; HMM-score: 49.8)
    tol-pal system protein YbgF (TIGR02795; HMM-score: 31.4)
    putative peptide modification system cyclase (TIGR04510; HMM-score: 26.2)
    Unknown function General heme biosynthesis-associated TPR protein (TIGR00540; HMM-score: 24.5)
    pentatricopeptide repeat domain (TIGR00756; HMM-score: 21.9)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides adenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 21.4)
    poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA (TIGR03939; HMM-score: 20.7)
  • TheSEED  :
    • Tetratricopeptide repeat (TPR) family protein
  • PFAM:
    TPR (CL0020) TPR_1; Tetratricopeptide repeat (PF00515; HMM-score: 99.7)
    TPR_2; Tetratricopeptide repeat (PF07719; HMM-score: 98.2)
    TPR_8; Tetratricopeptide repeat (PF13181; HMM-score: 93.3)
    TPR_11; TPR repeat (PF13414; HMM-score: 86.9)
    and 42 more
    TPR_12; Tetratricopeptide repeat (PF13424; HMM-score: 78.9)
    TPR_19; Tetratricopeptide repeat (PF14559; HMM-score: 68.3)
    TPR_17; Tetratricopeptide repeat (PF13431; HMM-score: 66.1)
    TPR_14; Tetratricopeptide repeat (PF13428; HMM-score: 62.1)
    TPR_16; Tetratricopeptide repeat (PF13432; HMM-score: 61.8)
    ANAPC3; Anaphase-promoting complex, cyclosome, subunit 3 (PF12895; HMM-score: 56.2)
    TPR_10; Tetratricopeptide repeat (PF13374; HMM-score: 50.4)
    TPR_7; Tetratricopeptide repeat (PF13176; HMM-score: 47)
    TPR_CcmH_CycH; Cytochrome c-type biogenesis protein H TPR domain (PF23914; HMM-score: 45.1)
    TPR_6; Tetratricopeptide repeat (PF13174; HMM-score: 43.4)
    TPR_Slam; Surface lipoprotein assembly modifier, N-terminal TPR repeats (PF24575; HMM-score: 36.4)
    TPR_20; Tetratricopeptide repeat (PF14561; HMM-score: 34.2)
    T7SS_EccA1_N; T7SS, ESX-1 secretion system protein EccA1, N-terminal domain (PF21545; HMM-score: 32.4)
    TPR_9; Tetratricopeptide repeat (PF13371; HMM-score: 30.1)
    TPR-S; Tetratricopeptide Repeats-Sensor (PF20308; HMM-score: 29.5)
    TOM20_plant; Plant specific mitochondrial import receptor subunit TOM20 (PF06552; HMM-score: 28.4)
    ARM_TT21_C; Tetratricopeptide repeat protein 21 C-terminal ARM domain (PF25063; HMM-score: 26.7)
    PPR; PPR repeat (PF01535; HMM-score: 24.9)
    TPR_NPHP3; Nephrocystin-3 TPR domain (PF24885; HMM-score: 23.4)
    TPR_15; Tetratricopeptide repeat (PF13429; HMM-score: 21.9)
    ARM_TT21_4th; Tetratricopeptide repeat protein 21 forth ARM domain (PF25068; HMM-score: 21.8)
    MIT (CL0745) MIT; MIT (microtubule interacting and transport) domain (PF04212; HMM-score: 20.2)
    TPR (CL0020) TPR_3; Tetratricopeptide repeat (PF07720; HMM-score: 20.2)
    ARM_TT21_N; Tetratricopeptide repeat protein 21 N-terminal ARM repeat (PF25062; HMM-score: 20.2)
    ARM_TT21_5th; TT21 fifth ARM repeats domain (PF25064; HMM-score: 19.9)
    ARM_TT21; Tetratricopeptide repeat protein 21 ARM repeat (PF25058; HMM-score: 19.7)
    E_motif; E motif (PF20431; HMM-score: 18.1)
    NatA_aux_su; N-terminal acetyltransferase A, auxiliary subunit (PF12569; HMM-score: 17.4)
    PPR_2; PPR repeat family (PF13041; HMM-score: 17.3)
    no clan defined MatP; MatP N-terminal domain (PF06303; HMM-score: 16)
    TPR (CL0020) TPR_4; Tetratricopeptide repeat (PF07721; HMM-score: 15.8)
    TPR_P4H; Prolyl 4-hydroxylase peptide-substrate-binding domain (PF23558; HMM-score: 15.5)
    SRP_TPR_like; Putative TPR-like repeat (PF17004; HMM-score: 14.2)
    TPR_27; Plant tetratrico peptide repeats (PF23310; HMM-score: 14.2)
    no clan defined DUF1512; Protein of unknown function (DUF1512) N-terminal domain (PF07431; HMM-score: 13.6)
    TPR (CL0020) TPR_21; Tetratricopeptide repeat-like domain (PF09976; HMM-score: 12.8)
    TPR_MalT; MalT-like TPR region (PF17874; HMM-score: 12.8)
    Hect (CL0552) HECT_2; HECT-like Ubiquitin-conjugating enzyme (E2)-binding (PF09814; HMM-score: 12.2)
    TPR (CL0020) EAD11; Effector-associated domain 11 (PF19964; HMM-score: 12.1)
    Sel1; Sel1 repeat (PF08238; HMM-score: 11.7)
    Clathrin; Region in Clathrin and VPS (PF00637; HMM-score: 11.6)
    NADP_Rossmann (CL0063) Bin3; Bicoid-interacting protein 3 (Bin3) (PF06859; HMM-score: 9.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8886
    • Cytoplasmic Membrane Score: 0.0614
    • Cell wall & surface Score: 0.016
    • Extracellular Score: 0.0341
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004087
    • TAT(Tat/SPI): 0.000163
    • LIPO(Sec/SPII): 0.000383
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIDQQTIYQYIQNGKIEEALQALFGNIEENPTIIENYINAGIVLADANEIEKAERFFQKALTIDPKNGVVFFNLANVYYNQQRYQEAIKLYQQALQTEIEQVDCNYMIGMAFNQLESFKLALPYLMTAAELDKDKDAEVQFQYGLVLCQLEMFNEAITQLKHVLTIDKNHVDARYNLGLALFMKNEDIDEAITHFKEAVTIDPKHLLSQHALKTFTKMKEEE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]