Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS01925 [old locus tag: NWMN_0340 ]
- pan locus tag?: SAUPAN001890000
- symbol: NWMN_RS01925
- pan gene symbol?: tatA
- synonym:
- product: twin-arginine translocase TatA/TatE family subunit
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS01925 [old locus tag: NWMN_0340 ]
- symbol: NWMN_RS01925
- product: twin-arginine translocase TatA/TatE family subunit
- replicon: chromosome
- strand: -
- coordinates: 390202..390426
- length: 225
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181TTGATTATCATGATAACTAACACTTTTATTTTAGGCATCACAGGCCCAACAAGTCTTGTC
GTCATTAGCATTATCGCTTTAATTATTTTTGGTCCGAAAAAATTACCACAATTTGGCCGT
GCCATCGGTTCTACTTTAAAAGAATTTAAATCTGCAACAGAAGATTTAGATAAAGAGTCT
CACGATACACCCAGTAAGGAATCGAAACAACAGCGAGAGCAATAG60
120
180
225
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS01925 [old locus tag: NWMN_0340 ]
- symbol: NWMN_RS01925
- description: twin-arginine translocase TatA/TatE family subunit
- length: 74
- theoretical pI: 9.23936
- theoretical MW: 8159.47
- GRAVY: -0.0378378
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase, TatA/E family (TIGR01411; HMM-score: 67.9)and 1 moreProtein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase TatB (TIGR01410; HMM-score: 34.3)
- TheSEED: see NWMN_0340
- PFAM: no clan defined TatA_B_E; mttA/Hcf106 family (PF02416; HMM-score: 70.9)and 1 moreCPP1-like; Protein CHAPERONE-LIKE PROTEIN OF POR1-like (PF11833; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9941
- Cell wall & surface Score: 0
- Extracellular Score: 0.0059
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.04799
- TAT(Tat/SPI): 0.00091
- LIPO(Sec/SPII): 0.003495
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIIMITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKESHDTPSKESKQQREQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: Fur* see NWMN_0340
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]