Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0418 [new locus tag: SACOL_RS02105 ]
- pan locus tag?: SAUPAN001890000
- symbol: SACOL0418
- pan gene symbol?: tatA
- synonym:
- product: mttA/Hcf106 family protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0418 [new locus tag: SACOL_RS02105 ]
- symbol: SACOL0418
- product: mttA/Hcf106 family protein
- replicon: chromosome
- strand: -
- coordinates: 424528..424743
- length: 216
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236523 NCBI
- RefSeq: YP_185310 NCBI
- BioCyc: see SACOL_RS02105
- MicrobesOnline: 911889 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATAACTAACACTTTTATTTTAGGCATCACAGGCCCAACAAGTCTTGTCGTCATTAGC
ATTATCGCTTTAATTATTTTTGGTCCGAAAAAATTACCACAATTTGGCCGTGCCATCGGT
TCTACTTTAAAAGAATTTAAATCTGCAACAGAAGATTTAGATAAAGAGTCTCACGATACA
CCCAGTAAGGAATCGAAACAACAGCGAGAGCAATAG60
120
180
216
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0418 [new locus tag: SACOL_RS02105 ]
- symbol: SACOL0418
- description: mttA/Hcf106 family protein
- length: 71
- theoretical pI: 9.23936
- theoretical MW: 7801.96
- GRAVY: -0.192958
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase, TatA/E family (TIGR01411; HMM-score: 68)and 1 moreProtein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase TatB (TIGR01410; HMM-score: 34.4)
- TheSEED :
- Twin-arginine translocation protein TatA
- PFAM: no clan defined TatA_B_E; mttA/Hcf106 family (PF02416; HMM-score: 71)and 1 moreCPP1-like; Protein CHAPERONE-LIKE PROTEIN OF POR1-like (PF11833; HMM-score: 11.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9949
- Cell wall & surface Score: 0
- Extracellular Score: 0.0051
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.116733
- TAT(Tat/SPI): 0.001642
- LIPO(Sec/SPII): 0.005787
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKESHDTPSKESKQQREQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: Fur* (repression) regulon
Fur* (TF) important in Iron homeostasis; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]