From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0340 [new locus tag: NWMN_RS01925 ]
  • pan locus tag?: SAUPAN001890000
  • symbol: tatA
  • pan gene symbol?: tatA
  • synonym:
  • product: twin-arginine translocation protein TatA

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0340 [new locus tag: NWMN_RS01925 ]
  • symbol: tatA
  • product: twin-arginine translocation protein TatA
  • replicon: chromosome
  • strand: -
  • coordinates: 390202..390417
  • length: 216
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATAACTAACACTTTTATTTTAGGCATCACAGGCCCAACAAGTCTTGTCGTCATTAGC
    ATTATCGCTTTAATTATTTTTGGTCCGAAAAAATTACCACAATTTGGCCGTGCCATCGGT
    TCTACTTTAAAAGAATTTAAATCTGCAACAGAAGATTTAGATAAAGAGTCTCACGATACA
    CCCAGTAAGGAATCGAAACAACAGCGAGAGCAATAG
    60
    120
    180
    216


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_0340 [new locus tag: NWMN_RS01925 ]
  • symbol: TatA
  • description: twin-arginine translocation protein TatA
  • length: 71
  • theoretical pI: 9.23936
  • theoretical MW: 7801.96
  • GRAVY: -0.192958

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase, TatA/E family (TIGR01411; HMM-score: 68)
    and 1 more
    Genetic information processing Protein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase TatB (TIGR01410; HMM-score: 34.4)
  • TheSEED  :
    • Twin-arginine translocation protein TatA
    Membrane Transport Protein translocation across cytoplasmic membrane Twin-arginine translocation system  Twin-arginine translocation protein TatA
  • PFAM:
    no clan defined TatA_B_E; mttA/Hcf106 family (PF02416; HMM-score: 71)
    and 1 more
    CPP1-like; Protein CHAPERONE-LIKE PROTEIN OF POR1-like (PF11833; HMM-score: 11.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9949
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0051
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.116733
    • TAT(Tat/SPI): 0.001642
    • LIPO(Sec/SPII): 0.005787
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKESHDTPSKESKQQREQ

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: Fur* (repression) regulon
    Fur*(TF)important in Iron homeostasis; RegPrecise 

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]