From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000301 [new locus tag: EGJ38_RS01505 ]
  • pan locus tag?: SAUPAN001890000
  • symbol: tatA
  • pan gene symbol?: tatA
  • synonym:
  • product: twin-arginine translocase TatA/TatE family subunit

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000301 [new locus tag: EGJ38_RS01505 ]
  • symbol: tatA
  • product: twin-arginine translocase TatA/TatE family subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 338536..338760
  • length: 225
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422304 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    TTGATTATCATGATAACTAACACTTTTATTTTAGGCATCACAGGTCCAACAAGTCTTGTC
    GTCATTAGCATTATCGCTTTAATTATTTTTGGTCCGAAAAAATTACCACAATTTGGTCGT
    GCTATCGGTTCTACTTTAAAAGAATTTAAATCTGCAACAGAAGATTTAGACAAAGAGTCT
    CACGACACACCCAGTAAGGAATCGAAACAACAGCGAGAGCAATAG
    60
    120
    180
    225

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000301 [new locus tag: EGJ38_RS01505 ]
  • symbol: TatA
  • description: twin-arginine translocase TatA/TatE family subunit
  • length: 74
  • theoretical pI: 9.23936
  • theoretical MW: 8159.47
  • GRAVY: -0.0378378

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase, TatA/E family (TIGR01411; HMM-score: 67.9)
    and 1 more
    Genetic information processing Protein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase TatB (TIGR01410; HMM-score: 34.3)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined TatA_B_E; mttA/Hcf106 family (PF02416; HMM-score: 70.9)
    and 1 more
    CPP1-like; Protein CHAPERONE-LIKE PROTEIN OF POR1-like (PF11833; HMM-score: 12.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9941
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0059
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.04799
    • TAT(Tat/SPI): 0.00091
    • LIPO(Sec/SPII): 0.003495
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422304 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MIIMITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKESHDTPSKESKQQREQ

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: Fur (repression) regulon
    Fur(TF)important in Iron homeostasis;  regulation predicted or transferred from N315 and NCTC 8325  [2]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]