From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1212 [new locus tag: NWMN_RS06815 ]
  • pan locus tag?: SAUPAN003619000
  • symbol: NWMN_1212
  • pan gene symbol?: hfq
  • synonym:
  • product: RNA chaperone, host factor-1 protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1212 [new locus tag: NWMN_RS06815 ]
  • symbol: NWMN_1212
  • product: RNA chaperone, host factor-1 protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1338596..1338829
  • length: 234
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATTGCAAACGAAAACATCCAAGACAAAGCACTAGAGAATTTTAAAGCAAACCAAACT
    GAAGTAACTGTATTCTTTCTAAACGGTTTCCAAATGAAAGGTGTTATTGAAGAATACGAC
    AAGTATGTCGTAAGCTTAAATTCTCAAGGCAAACAACACTTGATTTACAAACATGCGATC
    AGCACTTATACAGTAGAAACTGAAGGTCAAGCATCTACTGAAAGTGAAGAATAA
    60
    120
    180
    234

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_1212 [new locus tag: NWMN_RS06815 ]
  • symbol: NWMN_1212
  • description: RNA chaperone, host factor-1 protein
  • length: 77
  • theoretical pI: 4.39044
  • theoretical MW: 8778.67
  • GRAVY: -0.544156

⊟Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions Other RNA chaperone Hfq (TIGR02383; HMM-score: 104.1)
  • TheSEED  :
    • RNA-binding protein Hfq
    Stress Response Stress Response - no subcategory Hfl operon  RNA-binding protein Hfq
  • PFAM:
    SH3 (CL0010) Hfq; Hfq protein (PF17209; HMM-score: 90.3)
    and 4 more
    Hfq_1; Hfq related (PF21979; HMM-score: 17.9)
    MBG (CL0682) MBG; MBG domain (PF17883; HMM-score: 14.7)
    no clan defined DUF4809; Domain of unknown function (DUF4809) (PF16067; HMM-score: 13.7)
    PRTase-like (CL0533) StiP; Tellurite-like stress resistance cysteine protease StiP (PF11202; HMM-score: 12.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9622
    • Cytoplasmic Membrane Score: 0.0067
    • Cell wall & surface Score: 0.0026
    • Extracellular Score: 0.0285
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003191
    • TAT(Tat/SPI): 0.000423
    • LIPO(Sec/SPII): 0.000661
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTVETEGQASTESEE

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=NWMN_1212&oldid=64193"