PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

⊟Summary

• organism: Staphylococcus aureus N315
• locus tag: SA1145 [new locus tag: SA_RS06465 ]
• pan locus tag^?: SAUPAN003619000
• symbol: SA1145
• pan gene symbol^?: hfq
• synonym:
• product: hypothetical protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SA1145 [new locus tag: SA_RS06465 ]
• symbol: SA1145
• product: hypothetical protein
• replicon: chromosome
• strand: +
• coordinates: 1302997..1303230
• length: 234
• essential: no DEG other strains

⊟Accession numbers

• Gene ID: 1123978 NCBI
• RefSeq: NP_374420 NCBI
• BioCyc: see SA_RS06465
• MicrobesOnline: 103446 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  
  ATGATTGCAAACGAAAACATCCAAGACAAAGCACTAGAGAATTTTAAAGCAAACCAAACT
  GAAGTAACTGTATTCTTTCTAAACGGTTTCCAAATGAAAGGTGTTATTGAAGAATACGAC
  AAGTATGTCGTAAGCTTAAATTCTCAAGGCAAACAACACTTGATTTACAAACATGCGATC
  AGCACTTATACAGTAGAAACTGAAGGTCAAGCATCTACTGAAAGTGAAGAATAA
  60
  120
  180
  234
  

⊟Protein

⊟General

• locus tag: SA1145 [new locus tag: SA_RS06465 ]
• symbol: SA1145
• description: hypothetical protein
• length: 77
• theoretical pI: 4.39044
• theoretical MW: 8778.67
• GRAVY: -0.544156

⊟Function

• TIGRFAM:
  Signal transduction Regulatory functions Other RNA chaperone Hfq (TIGR02383; HMM-score: 104.1)
• TheSEED  :
  • RNA-binding protein Hfq
  Stress Response Stress Response - no subcategory Hfl operon  RNA-binding protein Hfq
• PFAM:
  Sm-like (CL0527) Hfq; Hfq protein (PF17209; HMM-score: 88.1)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Cytoplasmic
  • Cytoplasmic Score: 9.67
  • Cytoplasmic Membrane Score: 0.01
  • Cellwall Score: 0.15
  • Extracellular Score: 0.17
  • Internal Helices: 0
• LocateP: Intracellular
  • Prediction by SwissProt Classification: Cytoplasmic
  • Pathway Prediction: No pathway
  • Intracellular possibility: 1
  • Signal peptide possibility: -1
  • N-terminally Anchored Score: 1
  • Predicted Cleavage Site: No CleavageSite
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.003191
  • TAT(Tat/SPI): 0.000423
  • LIPO(Sec/SPII): 0.000661
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 15926887 NCBI
• RefSeq: NP_374420 NCBI
• UniProt: A0A0H3JKV2 UniProt

⊟Protein sequence

• MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTVETEGQASTESEE

⊟Experimental data

• experimentally validated: data available for NCTC8325
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: SA1143 > miaA > SA1145

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications

Eric Huntzinger, Sandrine Boisset, Cosmin Saveanu, Yvonne Benito, Thomas Geissmann, Abdelkader Namane, Gérard Lina, Jerome Etienne, Bernard Ehresmann, Chantal Ehresmann, Alain Jacquier, François Vandenesch, Pascale Romby
Staphylococcus aureus RNAIII and the endoribonuclease III coordinately regulate spa gene expression.
EMBO J: 2005, 24(4);824-35
[PubMed:15678100] [WorldCat.org] [DOI] (P p)