From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1145 [new locus tag: SA_RS06465 ]
  • pan locus tag?: SAUPAN003619000
  • symbol: SA1145
  • pan gene symbol?: hfq
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA1145 [new locus tag: SA_RS06465 ]
  • symbol: SA1145
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1302997..1303230
  • length: 234
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATTGCAAACGAAAACATCCAAGACAAAGCACTAGAGAATTTTAAAGCAAACCAAACT
    GAAGTAACTGTATTCTTTCTAAACGGTTTCCAAATGAAAGGTGTTATTGAAGAATACGAC
    AAGTATGTCGTAAGCTTAAATTCTCAAGGCAAACAACACTTGATTTACAAACATGCGATC
    AGCACTTATACAGTAGAAACTGAAGGTCAAGCATCTACTGAAAGTGAAGAATAA
    60
    120
    180
    234


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA1145 [new locus tag: SA_RS06465 ]
  • symbol: SA1145
  • description: hypothetical protein
  • length: 77
  • theoretical pI: 4.39044
  • theoretical MW: 8778.67
  • GRAVY: -0.544156

⊟Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions Other RNA chaperone Hfq (TIGR02383; HMM-score: 104.1)
  • TheSEED  :
    • RNA-binding protein Hfq
    Stress Response Stress Response - no subcategory Hfl operon  RNA-binding protein Hfq
  • PFAM:
    SH3 (CL0010) Hfq; Hfq protein (PF17209; HMM-score: 90.3)
    and 4 more
    Hfq_1; Hfq related (PF21979; HMM-score: 17.9)
    MBG (CL0682) MBG; MBG domain (PF17883; HMM-score: 14.7)
    no clan defined DUF4809; Domain of unknown function (DUF4809) (PF16067; HMM-score: 13.7)
    PRTase-like (CL0533) StiP; Tellurite-like stress resistance cysteine protease StiP (PF11202; HMM-score: 12.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9622
    • Cytoplasmic Membrane Score: 0.0067
    • Cell wall & surface Score: 0.0026
    • Extracellular Score: 0.0285
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003191
    • TAT(Tat/SPI): 0.000423
    • LIPO(Sec/SPII): 0.000661
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTVETEGQASTESEE

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]

Eric Huntzinger, Sandrine Boisset, Cosmin Saveanu, Yvonne Benito, Thomas Geissmann, Abdelkader Namane, Gérard Lina, Jerome Etienne, Bernard Ehresmann, Chantal Ehresmann, Alain Jacquier, François Vandenesch, Pascale Romby
Staphylococcus aureus RNAIII and the endoribonuclease III coordinately regulate spa gene expression.
EMBO J: 2005, 24(4);824-35
[PubMed:15678100] [WorldCat.org] [DOI] (P p)

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA1145&oldid=127405"