Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS06815 [old locus tag: NWMN_1212 ]
- pan locus tag?: SAUPAN003619000
- symbol: NWMN_RS06815
- pan gene symbol?: hfq
- synonym:
- product: RNA-binding protein Hfq
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS06815 [old locus tag: NWMN_1212 ]
- symbol: NWMN_RS06815
- product: RNA-binding protein Hfq
- replicon: chromosome
- strand: +
- coordinates: 1338596..1338829
- length: 234
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATTGCAAACGAAAACATCCAAGACAAAGCACTAGAGAATTTTAAAGCAAACCAAACT
GAAGTAACTGTATTCTTTCTAAACGGTTTCCAAATGAAAGGTGTTATTGAAGAATACGAC
AAGTATGTCGTAAGCTTAAATTCTCAAGGCAAACAACACTTGATTTACAAACATGCGATC
AGCACTTATACAGTAGAAACTGAAGGTCAAGCATCTACTGAAAGTGAAGAATAA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS06815 [old locus tag: NWMN_1212 ]
- symbol: NWMN_RS06815
- description: RNA-binding protein Hfq
- length: 77
- theoretical pI: 4.39044
- theoretical MW: 8778.67
- GRAVY: -0.544156
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions Other RNA chaperone Hfq (TIGR02383; HMM-score: 104.1)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: Sm-like (CL0527) Hfq; Hfq protein (PF17209; HMM-score: 88.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003191
- TAT(Tat/SPI): 0.000423
- LIPO(Sec/SPII): 0.000661
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTVETEGQASTESEE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.