Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_002401
- pan locus tag?: SAUPAN005968000
- symbol: JSNZ_002401
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_002401
- symbol: JSNZ_002401
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2397892..2398059
- length: 168
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGCAATTATTAATTTTAACTGACATATTTTATCGAATCGCTGTTTATATCTGCCTGAAT
TCCTTAAGAAGTCTTAGTCATTTCAATAGCAAGGTCAAAATTTTGCCAAAATTTATAGTT
ATACTGAGAAGTTTAAATTCATGTTTTCTTGAAAAACATGCGCCTTAA60
120
168
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_002401
- symbol: JSNZ_002401
- description: hypothetical protein
- length: 55
- theoretical pI: 10.2465
- theoretical MW: 6421.76
- GRAVY: 0.654545
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined DUF5408; Family of unknown function (DUF5408) (PF17402; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7787
- Cytoplasmic Membrane Score: 0.0157
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.2054
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.025073
- TAT(Tat/SPI): 0.000916
- LIPO(Sec/SPII): 0.017631
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MQLLILTDIFYRIAVYICLNSLRSLSHFNSKVKILPKFIVILRSLNSCFLEKHAP
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : JSNZ_002395 < JSNZ_002396 < JSNZ_002397 < bioB < bioA < bioD < JSNZ_002401
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)