Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_000804
- pan locus tag?: SAUPAN002898000
- symbol: sufU
- pan gene symbol?: sufU
- synonym:
- product: Fe-S cluster assembly sulfur transfer protein SufU
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_000804
- symbol: sufU
- product: Fe-S cluster assembly sulfur transfer protein SufU
- replicon: chromosome
- strand: +
- coordinates: 834598..835062
- length: 465
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAATTTTAATAATCTAGATCAATTATATAGATCTGTCATTATGGATCATTATAAAAAT
CCTAGAAATAAAGGTGTATTAGATAACGGGTCTATGACAGTAGATATGAATAACCCGACA
TGCGGTGACCGTATACGACTAACATTTGATATAGAAGACGGCATTATAAAAGATGCTAAG
TTTGAAGGTGAAGGTTGTTCGATTTCAATGGCAAGTGCATCGATGATGACACAAGCTGTT
AAAGGTCATTCACTTGGAGAAGCAATGCAAATGAGCCAAGAATTTACGAAAATGATGCTT
GGTGAAGACTATGTGATTACAGAAGAAATGGGAGATATTGAAGCATTGCAAGGTGTATCT
CAATTCCCAGCTCGTATTAAATGTGCCACATTAGCTTGGAAAGCATTGGAAAAAGGTACT
GTTGCTAAAGAAGGTAAAGCAGAAGGTACGACTGAAGAAGAATAG60
120
180
240
300
360
420
465
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_000804
- symbol: SufU
- description: Fe-S cluster assembly sulfur transfer protein SufU
- length: 154
- theoretical pI: 4.4445
- theoretical MW: 17016.3
- GRAVY: -0.43961
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Other SUF system FeS assembly protein, NifU family (TIGR01994; HMM-score: 184.2)and 6 moreBiosynthesis of cofactors, prosthetic groups, and carriers Other FeS cluster assembly scaffold protein NifU (TIGR03419; HMM-score: 88.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS cluster assembly scaffold IscU (TIGR01999; HMM-score: 73.9)Biosynthesis of cofactors, prosthetic groups, and carriers Other Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 58.4)Central intermediary metabolism Nitrogen fixation Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 58.4)soluble methane monooxygenase-binding protein MmoD (TIGR04550; HMM-score: 13.9)Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (TIGR00097; EC 2.7.1.49,2.7.4.7; HMM-score: 13.7)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: SufE_NifU (CL0233) NifU_N; NifU-like N terminal domain (PF01592; HMM-score: 122.9)and 3 moreRibokinase (CL0118) Phos_pyr_kin; Phosphomethylpyrimidine kinase (PF08543; HMM-score: 16.2)no clan defined TSCPD; TSCPD domain (PF12637; HMM-score: 14.3)SufE_NifU (CL0233) Lip_prot_lig_C; Bacterial lipoate protein ligase C-terminus (PF10437; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9843
- Cytoplasmic Membrane Score: 0.0009
- Cell wall & surface Score: 0
- Extracellular Score: 0.0148
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.012339
- TAT(Tat/SPI): 0.000348
- LIPO(Sec/SPII): 0.001049
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MNFNNLDQLYRSVIMDHYKNPRNKGVLDNGSMTVDMNNPTCGDRIRLTFDIEDGIIKDAKFEGEGCSISMASASMMTQAVKGHSLGEAMQMSQEFTKMMLGEDYVITEEMGDIEALQGVSQFPARIKCATLAWKALEKGTVAKEGKAEGTTEEE
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
Curr Res Microb Sci: 2025, 9;100489
[PubMed:41146725] [WorldCat.org] [DOI] (I e)