Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0917 [new locus tag: SACOL_RS04705 ]
- pan locus tag?: SAUPAN002898000
- symbol: SACOL0917
- pan gene symbol?: sufU
- synonym:
- product: NifU domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0917 [new locus tag: SACOL_RS04705 ]
- symbol: SACOL0917
- product: NifU domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 924755..925219
- length: 465
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237763 NCBI
- RefSeq: YP_185788 NCBI
- BioCyc: see SACOL_RS04705
- MicrobesOnline: 912388 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAATTTTAATAATCTAGATCAATTATATAGATCTGTCATTATGGATCATTATAAAAAT
CCTAGAAATAAAGGTGTATTAGATAACGGGTCTATGACAGTAGATATGAATAACCCGACA
TGCGGTGACCGTATACGACTAACATTTGATATAGAAGACGGCATTATAAAAGATGCTAAG
TTTGAAGGTGAAGGTTGTTCGATTTCAATGGCAAGTGCATCGATGATGACACAAGCTGTT
AAAGGTCATTCACTTGGAGAAGCAATGCAAATGAGCCAAGAATTTACGAAAATGATGCTT
GGTGAAGACTATGTGATTACAGAAGAAATGGGAGATATTGAAGCATTGCAAGGTGTATCT
CAATTCCCAGCTCGTATTAAATGTGCCACATTAGCTTGGAAAGCATTGGAAAAAGGTACT
GTTGCTAAAGAAGGTAAAGCAGAAGGTACGACTGAAGAAGAATAG60
120
180
240
300
360
420
465
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0917 [new locus tag: SACOL_RS04705 ]
- symbol: SACOL0917
- description: NifU domain-containing protein
- length: 154
- theoretical pI: 4.4445
- theoretical MW: 17016.3
- GRAVY: -0.43961
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Other SUF system FeS assembly protein, NifU family (TIGR01994; HMM-score: 184.2)and 6 moreBiosynthesis of cofactors, prosthetic groups, and carriers Other FeS cluster assembly scaffold protein NifU (TIGR03419; HMM-score: 88.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS cluster assembly scaffold IscU (TIGR01999; HMM-score: 73.9)Biosynthesis of cofactors, prosthetic groups, and carriers Other Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 58.4)Central intermediary metabolism Nitrogen fixation Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 58.4)soluble methane monooxygenase-binding protein MmoD (TIGR04550; HMM-score: 13.9)Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (TIGR00097; EC 2.7.1.49,2.7.4.7; HMM-score: 13.7)
- TheSEED :
- Putative iron-sulfur cluster assembly scaffold protein for SUF system, SufE2
- PFAM: SufE_NifU (CL0233) NifU_N; NifU-like N terminal domain (PF01592; HMM-score: 122.9)and 3 moreRibokinase (CL0118) Phos_pyr_kin; Phosphomethylpyrimidine kinase (PF08543; HMM-score: 16.2)no clan defined TSCPD; TSCPD domain (PF12637; HMM-score: 14.3)SufE_NifU (CL0233) Lip_prot_lig_C; Bacterial lipoate protein ligase C-terminus (PF10437; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9843
- Cytoplasmic Membrane Score: 0.0009
- Cell wall & surface Score: 0
- Extracellular Score: 0.0148
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.012339
- TAT(Tat/SPI): 0.000348
- LIPO(Sec/SPII): 0.001049
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNFNNLDQLYRSVIMDHYKNPRNKGVLDNGSMTVDMNNPTCGDRIRLTFDIEDGIIKDAKFEGEGCSISMASASMMTQAVKGHSLGEAMQMSQEFTKMMLGEDYVITEEMGDIEALQGVSQFPARIKCATLAWKALEKGTVAKEGKAEGTTEEE
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: PerR* (repression) regulon
PerR* (TF) important in Oxidative stress response; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 15.73 h [6]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
