From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0821 [new locus tag: SAUSA300_RS04425 ]
  • pan locus tag?: SAUPAN002898000
  • symbol: SAUSA300_0821
  • pan gene symbol?: sufU
  • synonym: JSNZ_000804
  • product: NifU family SUF system FeS assembly protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0821 [new locus tag: SAUSA300_RS04425 ]
  • symbol: SAUSA300_0821
  • product: NifU family SUF system FeS assembly protein
  • replicon: chromosome
  • strand: +
  • coordinates: 901281..901745
  • length: 465
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAATTTTAATAATCTAGATCAATTATATAGATCTGTCATTATGGATCATTATAAAAAT
    CCTAGAAATAAAGGTGTATTAGATAACGGGTCTATGACAGTAGATATGAATAACCCGACA
    TGCGGTGACCGTATACGACTAACATTTGATATAGAAGACGGCATTATAAAAGATGCTAAG
    TTTGAAGGTGAAGGTTGTTCGATTTCAATGGCAAGTGCATCGATGATGACACAAGCTGTT
    AAAGGTCATTCACTTGGAGAAGCAATGCAAATGAGCCAAGAATTTACGAAAATGATGCTT
    GGTGAAGACTATGTGATTACAGAAGAAATGGGAGATATTGAAGCATTGCAAGGTGTATCT
    CAATTCCCAGCTCGTATTAAATGTGCCACATTAGCTTGGAAAGCATTGGAAAAAGGTACT
    GTTGCTAAAGAAGGTAAAGCAGAAGGTACGACTGAAGAAGAATAG
    60
    120
    180
    240
    300
    360
    420
    465

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0821 [new locus tag: SAUSA300_RS04425 ]
  • symbol: SAUSA300_0821
  • description: NifU family SUF system FeS assembly protein
  • length: 154
  • theoretical pI: 4.4445
  • theoretical MW: 17016.3
  • GRAVY: -0.43961

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other SUF system FeS assembly protein, NifU family (TIGR01994; HMM-score: 184.2)
    and 6 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS cluster assembly scaffold protein NifU (TIGR03419; HMM-score: 88.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS cluster assembly scaffold IscU (TIGR01999; HMM-score: 73.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 58.4)
    Metabolism Central intermediary metabolism Nitrogen fixation Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 58.4)
    soluble methane monooxygenase-binding protein MmoD (TIGR04550; HMM-score: 13.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (TIGR00097; EC 2.7.1.49,2.7.4.7; HMM-score: 13.7)
  • TheSEED  :
    • Iron-sulfur cluster assembly scaffold protein SufU
  • PFAM:
    SufE_NifU (CL0233) NifU_N; NifU-like N terminal domain (PF01592; HMM-score: 122.9)
    and 3 more
    Ribokinase (CL0118) Phos_pyr_kin; Phosphomethylpyrimidine kinase (PF08543; HMM-score: 16.2)
    no clan defined TSCPD; TSCPD domain (PF12637; HMM-score: 14.3)
    SufE_NifU (CL0233) Lip_prot_lig_C; Bacterial lipoate protein ligase C-terminus (PF10437; HMM-score: 13.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9843
    • Cytoplasmic Membrane Score: 0.0009
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0148
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.012339
    • TAT(Tat/SPI): 0.000348
    • LIPO(Sec/SPII): 0.001049
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNFNNLDQLYRSVIMDHYKNPRNKGVLDNGSMTVDMNNPTCGDRIRLTFDIEDGIIKDAKFEGEGCSISMASASMMTQAVKGHSLGEAMQMSQEFTKMMLGEDYVITEEMGDIEALQGVSQFPARIKCATLAWKALEKGTVAKEGKAEGTTEEE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: PerR*/JSNZ_001889 (repression) regulon
    PerR*/JSNZ_001889(TF)important in Oxidative stress response; RegPrecise    transcription unit transferred from N315 data RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]