Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0821 [new locus tag: SAUSA300_RS04425 ]
- pan locus tag?: SAUPAN002898000
- symbol: SAUSA300_0821
- pan gene symbol?: sufU
- synonym: JSNZ_000804
- product: NifU family SUF system FeS assembly protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0821 [new locus tag: SAUSA300_RS04425 ]
- symbol: SAUSA300_0821
- product: NifU family SUF system FeS assembly protein
- replicon: chromosome
- strand: +
- coordinates: 901281..901745
- length: 465
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3915259 NCBI
- RefSeq: YP_493521 NCBI
- BioCyc: see SAUSA300_RS04425
- MicrobesOnline: 1292336 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAATTTTAATAATCTAGATCAATTATATAGATCTGTCATTATGGATCATTATAAAAAT
CCTAGAAATAAAGGTGTATTAGATAACGGGTCTATGACAGTAGATATGAATAACCCGACA
TGCGGTGACCGTATACGACTAACATTTGATATAGAAGACGGCATTATAAAAGATGCTAAG
TTTGAAGGTGAAGGTTGTTCGATTTCAATGGCAAGTGCATCGATGATGACACAAGCTGTT
AAAGGTCATTCACTTGGAGAAGCAATGCAAATGAGCCAAGAATTTACGAAAATGATGCTT
GGTGAAGACTATGTGATTACAGAAGAAATGGGAGATATTGAAGCATTGCAAGGTGTATCT
CAATTCCCAGCTCGTATTAAATGTGCCACATTAGCTTGGAAAGCATTGGAAAAAGGTACT
GTTGCTAAAGAAGGTAAAGCAGAAGGTACGACTGAAGAAGAATAG60
120
180
240
300
360
420
465
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0821 [new locus tag: SAUSA300_RS04425 ]
- symbol: SAUSA300_0821
- description: NifU family SUF system FeS assembly protein
- length: 154
- theoretical pI: 4.4445
- theoretical MW: 17016.3
- GRAVY: -0.43961
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Other SUF system FeS assembly protein, NifU family (TIGR01994; HMM-score: 184.2)and 6 moreBiosynthesis of cofactors, prosthetic groups, and carriers Other FeS cluster assembly scaffold protein NifU (TIGR03419; HMM-score: 88.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS cluster assembly scaffold IscU (TIGR01999; HMM-score: 73.9)Biosynthesis of cofactors, prosthetic groups, and carriers Other Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 58.4)Central intermediary metabolism Nitrogen fixation Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 58.4)soluble methane monooxygenase-binding protein MmoD (TIGR04550; HMM-score: 13.9)Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (TIGR00097; EC 2.7.1.49,2.7.4.7; HMM-score: 13.7)
- TheSEED :
- Iron-sulfur cluster assembly scaffold protein SufU
- PFAM: SufE_NifU (CL0233) NifU_N; NifU-like N terminal domain (PF01592; HMM-score: 122.9)and 3 moreRibokinase (CL0118) Phos_pyr_kin; Phosphomethylpyrimidine kinase (PF08543; HMM-score: 16.2)no clan defined TSCPD; TSCPD domain (PF12637; HMM-score: 14.3)SufE_NifU (CL0233) Lip_prot_lig_C; Bacterial lipoate protein ligase C-terminus (PF10437; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9843
- Cytoplasmic Membrane Score: 0.0009
- Cell wall & surface Score: 0
- Extracellular Score: 0.0148
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.012339
- TAT(Tat/SPI): 0.000348
- LIPO(Sec/SPII): 0.001049
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNFNNLDQLYRSVIMDHYKNPRNKGVLDNGSMTVDMNNPTCGDRIRLTFDIEDGIIKDAKFEGEGCSISMASASMMTQAVKGHSLGEAMQMSQEFTKMMLGEDYVITEEMGDIEALQGVSQFPARIKCATLAWKALEKGTVAKEGKAEGTTEEE
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: sufC > sufD > sufS > SAUSA300_0821 > sufB
⊟Regulation[edit | edit source]
- regulator: PerR*/JSNZ_001889 (repression) regulon
PerR*/JSNZ_001889 (TF) important in Oxidative stress response; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]