Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_000376
- pan locus tag?: SAUPAN002150000
- symbol: JSNZ_000376
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_000376
- symbol: JSNZ_000376
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 408881..409177
- length: 297
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAGTCCAATGGTAGGACCAGTTATAGGACCGGATATAGTACCGAGTATATCGTCAATG
ATAAAGGATGCTCAAAAAGTAAATATTCGCACAGTTATTGCACCTGAACATAAGAAAAAA
CAGAAAAATATTGAAAATGAATTAAAAGGTGAAGAAAAAGTATTGATTGAACAAATGGCG
CAGCATTGCGAAGCTTTTAAAGCTAATTTTAAAGGCGCAGCTCAAGGAGATTGGGTTAAA
AGTGCCATGTCTGAGATAGACAGTATTAAGGATGGTTTGAAAAAAATTAATAGCTAA60
120
180
240
297
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_000376
- symbol: JSNZ_000376
- description: hypothetical protein
- length: 98
- theoretical pI: 9.21868
- theoretical MW: 10774.5
- GRAVY: -0.429592
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.4057
- Cytoplasmic Membrane Score: 0.0049
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.5892
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.018256
- TAT(Tat/SPI): 0.001026
- LIPO(Sec/SPII): 0.001843
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MSPMVGPVIGPDIVPSISSMIKDAQKVNIRTVIAPEHKKKQKNIENELKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDGLKKINS
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : JSNZ_000373 > JSNZ_000374 > JSNZ_000375 > JSNZ_000376
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)