Jump to navigation
		Jump to search
		
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_000375
- pan locus tag?: SAUPAN002149000
- symbol: JSNZ_000375
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_000375
- symbol: JSNZ_000375
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 408539..408862
- length: 324
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241
 301ATGATGTTCAATCGAATTAATAATAAAAATGAATTAGAAGAATCATATGAATATGAGAAA
 AAACGTATAGAGAATAAACTGCAAAATTTGAATGAGTTTAGGCATAGAGCTCGAAAAGAA
 AATGAACGTAGTTATGATGTTTTTCAATATTTGAAACACGAAATGAATTATAGTGAAGAT
 GCACAAAGGAAAATGACGAGAAATATAGAAGCGTATGAGCAAGAAATCAATGAGATAATT
 AGAAAGCAAGAATGGAAATTAGAAGAATATAAAGAAGACTTAAAAAAATCTTATAAAAAT
 CAGTTAGATAAACTAAGTGATTGA60
 120
 180
 240
 300
 324
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_000375
- symbol: JSNZ_000375
- description: hypothetical protein
- length: 107
- theoretical pI: 6.55742
- theoretical MW: 13550
- GRAVY: -1.69626
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 6.9)and 1 moretwo transmembrane protein (TIGR04527; HMM-score: 5.5)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined Cluap1; Clusterin-associated protein-1 (PF10234; HMM-score: 20.9)and 15 moreKxDL; Uncharacterized conserved protein (PF10241; HMM-score: 13.6)KNTase_C (CL0291) HepT-like_2; HepT-like protein (PF20797; HMM-score: 13.5)no clan defined ISG65-75; Invariant surface glycoprotein (PF11727; HMM-score: 12.7)6PGD_C (CL0106) Octopine_DH; NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain (PF02317; HMM-score: 12.6)dUTPase (CL0153) Herpes_U55; Human herpesvirus U55 protein (PF06501; HMM-score: 12.6)no clan defined OVT1; Major antigen, helical domain (PF24423; HMM-score: 12.2)LTXXQ-like (CL0515) DUF4890; Domain of unknown function (DUF4890) (PF16231; HMM-score: 10.8)VBS-like (CL0705) HIP1_clath_bdg; Clathrin-binding domain of Huntingtin-interacting protein 1 (PF16515; HMM-score: 10.2)no clan defined Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 10.1)CREPT; Cell-cycle alteration and expression-elevated protein in tumour (PF16566; HMM-score: 9.7)YlqD; YlqD protein (PF11068; HMM-score: 8.6)ATP_synthase (CL0255) V-ATPase_G_2; Vacuolar (H+)-ATPase G subunit (PF16999; HMM-score: 8.6)no clan defined Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 8.5)GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 7.2)no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 4.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
 
- DeepLocPro: Extracellular- Cytoplasmic Score: 0.2654
- Cytoplasmic Membrane Score: 0.0429
- Cell wall & surface Score: 0.0115
- Extracellular Score: 0.6803
 
- LocateP:
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.008222
- TAT(Tat/SPI): 0.000663
- LIPO(Sec/SPII): 0.001293
 
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MMFNRINNKNELEESYEYEKKRIENKLQNLNEFRHRARKENERSYDVFQYLKHEMNYSEDAQRKMTRNIEAYEQEINEIIRKQEWKLEEYKEDLKKSYKNQLDKLSD
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : JSNZ_000373 > JSNZ_000374 > JSNZ_000375 > JSNZ_000376
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino  
 Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
 Bioinformatics: 2018, 34(23);4118-4120
 [PubMed:29931111] [WorldCat.org] [DOI] (I p)