From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0488 [new locus tag: SACOL_RS02470 ]
  • pan locus tag?: SAUPAN002149000
  • symbol: SACOL0488
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0488 [new locus tag: SACOL_RS02470 ]
  • symbol: SACOL0488
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 489723..490046
  • length: 324
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATGTTTAATCAAATTAATAATAAAAATGAATTAGAAGAATCATATGAATCTGAGAAA
    AAACGTATAGAGAATGAACTGCAAAATTTAAATGAACTTAGGCATAGAACTCGAAAAGAA
    AATGAACGTAGTTATGATGTTTTTCAATATTTGAAGCACGAAATGAATTATAGTGAAGAT
    GCCCAAAGGAAAATGACGAGAAATATAGAAGCGTATGAGCAAGAAATCAATGAGATAATT
    AGAAAGCAAGAATGGAAATTAGAAGAATATAAAGAAGACTTAAAAAAGTCTTATGAAAAG
    CAGTTAGATAAGCTAAGTGACTGA
    60
    120
    180
    240
    300
    324


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL0488 [new locus tag: SACOL_RS02470 ]
  • symbol: SACOL0488
  • description: hypothetical protein
  • length: 107
  • theoretical pI: 4.94933
  • theoretical MW: 13457.8
  • GRAVY: -1.69252

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 9)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 9)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 7.9)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 7.9)
    and 4 more
    Genetic information processing DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 5.6)
    two transmembrane protein (TIGR04527; HMM-score: 5.6)
    Genetic information processing Transcription Degradation of RNA ribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 3.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 3.1)
  • TheSEED  :
    • FIG01107979: hypothetical protein
  • PFAM:
    no clan defined Cluap1; Clusterin-associated protein-1 (PF10234; HMM-score: 16.5)
    ISG65-75; Invariant surface glycoprotein (PF11727; HMM-score: 15.6)
    dUTPase (CL0153) Herpes_U55; Human herpesvirus U55 protein (PF06501; HMM-score: 14.1)
    and 15 more
    6PGD_C (CL0106) Octopine_DH; NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain (PF02317; HMM-score: 12.2)
    no clan defined KxDL; Uncharacterized conserved protein (PF10241; HMM-score: 12.1)
    OVT1; Major antigen, helical domain (PF24423; HMM-score: 12)
    YlqD; YlqD protein (PF11068; HMM-score: 11.3)
    PEP-utilisers_N; PEP-utilising enzyme, N-terminal (PF05524; HMM-score: 10.9)
    LTXXQ-like (CL0515) DUF4890; Domain of unknown function (DUF4890) (PF16231; HMM-score: 10.3)
    no clan defined Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 10.1)
    VBS-like (CL0705) HIP1_clath_bdg; Clathrin-binding domain of Huntingtin-interacting protein 1 (PF16515; HMM-score: 10)
    ATP_synthase (CL0255) V-ATPase_G_2; Vacuolar (H+)-ATPase G subunit (PF16999; HMM-score: 8.3)
    no clan defined Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 8.1)
    CREPT; Cell-cycle alteration and expression-elevated protein in tumour (PF16566; HMM-score: 8)
    UPF0242; Uncharacterised protein family (UPF0242) N-terminus (PF06785; HMM-score: 7.3)
    P-loop_NTPase (CL0023) SRPRB; Signal recognition particle receptor beta subunit (PF09439; HMM-score: 6.5)
    GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 6.5)
    no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 4.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.349
    • Cytoplasmic Membrane Score: 0.0534
    • Cell wall & surface Score: 0.022
    • Extracellular Score: 0.5756
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005221
    • TAT(Tat/SPI): 0.000691
    • LIPO(Sec/SPII): 0.001015
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MMFNQINNKNELEESYESEKKRIENELQNLNELRHRTRKENERSYDVFQYLKHEMNYSEDAQRKMTRNIEAYEQEINEIIRKQEWKLEEYKEDLKKSYEKQLDKLSD

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell: 184 [3]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: 10.28 h [4]

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  4. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]