From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000375 [new locus tag: EGJ38_RS01875 ]
  • pan locus tag?: SAUPAN002149000
  • symbol: EGJ38_000375
  • pan gene symbol?: —
  • synonym:
  • alternate name: JSNZ_000375
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000375 [new locus tag: EGJ38_RS01875 ]
  • symbol: EGJ38_000375
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 408539..408862
  • length: 324
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422376 NCBI
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATGTTCAATCGAATTAATAATAAAAATGAATTAGAAGAATCATATGAATATGAGAAA
    AAACGTATAGAGAATAAACTGCAAAATTTGAATGAGTTTAGGCATAGAGCTCGAAAAGAA
    AATGAACGTAGTTATGATGTTTTTCAATATTTGAAACACGAAATGAATTATAGTGAAGAT
    GCACAAAGGAAAATGACGAGAAATATAGAAGCGTATGAGCAAGAAATCAATGAGATAATT
    AGAAAGCAAGAATGGAAATTAGAAGAATATAAAGAAGACTTAAAAAAATCTTATAAAAAT
    CAGTTAGATAAACTAAGTGATTGA
    60
    120
    180
    240
    300
    324


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: EGJ38_000375 [new locus tag: EGJ38_RS01875 ]
  • symbol: EGJ38_000375
  • description: hypothetical protein
  • length: 107
  • theoretical pI: 6.55742
  • theoretical MW: 13550
  • GRAVY: -1.69626

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 6.9)
    and 1 more
    two transmembrane protein (TIGR04527; HMM-score: 5.5)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined Cluap1; Clusterin-associated protein-1 (PF10234; HMM-score: 20.9)
    and 15 more
    KxDL; Uncharacterized conserved protein (PF10241; HMM-score: 13.6)
    KNTase_C (CL0291) HepT-like_2; HepT-like protein (PF20797; HMM-score: 13.5)
    no clan defined ISG65-75; Invariant surface glycoprotein (PF11727; HMM-score: 12.7)
    6PGD_C (CL0106) Octopine_DH; NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain (PF02317; HMM-score: 12.6)
    dUTPase (CL0153) Herpes_U55; Human herpesvirus U55 protein (PF06501; HMM-score: 12.6)
    no clan defined OVT1; Major antigen, helical domain (PF24423; HMM-score: 12.2)
    LTXXQ-like (CL0515) DUF4890; Domain of unknown function (DUF4890) (PF16231; HMM-score: 10.8)
    VBS-like (CL0705) HIP1_clath_bdg; Clathrin-binding domain of Huntingtin-interacting protein 1 (PF16515; HMM-score: 10.2)
    no clan defined Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 10.1)
    CREPT; Cell-cycle alteration and expression-elevated protein in tumour (PF16566; HMM-score: 9.7)
    YlqD; YlqD protein (PF11068; HMM-score: 8.6)
    ATP_synthase (CL0255) V-ATPase_G_2; Vacuolar (H+)-ATPase G subunit (PF16999; HMM-score: 8.6)
    no clan defined Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 8.5)
    GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 7.2)
    no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 4.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.2654
    • Cytoplasmic Membrane Score: 0.0429
    • Cell wall & surface Score: 0.0115
    • Extracellular Score: 0.6803
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008222
    • TAT(Tat/SPI): 0.000663
    • LIPO(Sec/SPII): 0.001293
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422376 NCBI
  • UniProt:

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MMFNRINNKNELEESYEYEKKRIENKLQNLNEFRHRARKENERSYDVFQYLKHEMNYSEDAQRKMTRNIEAYEQEINEIIRKQEWKLEEYKEDLKKSYKNQLDKLSD

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]