Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS02470 [old locus tag: SACOL0488 ]
- pan locus tag?: SAUPAN002149000
- symbol: SACOL_RS02470
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS02470 [old locus tag: SACOL0488 ]
- symbol: SACOL_RS02470
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 489723..490046
- length: 324
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATGTTTAATCAAATTAATAATAAAAATGAATTAGAAGAATCATATGAATCTGAGAAA
AAACGTATAGAGAATGAACTGCAAAATTTAAATGAACTTAGGCATAGAACTCGAAAAGAA
AATGAACGTAGTTATGATGTTTTTCAATATTTGAAGCACGAAATGAATTATAGTGAAGAT
GCCCAAAGGAAAATGACGAGAAATATAGAAGCGTATGAGCAAGAAATCAATGAGATAATT
AGAAAGCAAGAATGGAAATTAGAAGAATATAAAGAAGACTTAAAAAAGTCTTATGAAAAG
CAGTTAGATAAGCTAAGTGACTGA60
120
180
240
300
324
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS02470 [old locus tag: SACOL0488 ]
- symbol: SACOL_RS02470
- description: hypothetical protein
- length: 107
- theoretical pI: 4.94933
- theoretical MW: 13457.8
- GRAVY: -1.69252
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 9)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 9)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 7.9)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 7.9)and 4 moreDNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 5.6)two transmembrane protein (TIGR04527; HMM-score: 5.6)Transcription Degradation of RNA ribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 3.6)Protein fate Protein and peptide secretion and trafficking type I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 3.1)
- TheSEED: see SACOL0488
- PFAM: no clan defined Cluap1; Clusterin-associated protein-1 (PF10234; HMM-score: 16.5)ISG65-75; Invariant surface glycoprotein (PF11727; HMM-score: 15.6)dUTPase (CL0153) Herpes_U55; Human herpesvirus U55 protein (PF06501; HMM-score: 14.1)and 15 more6PGD_C (CL0106) Octopine_DH; NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain (PF02317; HMM-score: 12.2)no clan defined KxDL; Uncharacterized conserved protein (PF10241; HMM-score: 12.1)OVT1; Major antigen, helical domain (PF24423; HMM-score: 12)YlqD; YlqD protein (PF11068; HMM-score: 11.3)PEP-utilisers_N; PEP-utilising enzyme, N-terminal (PF05524; HMM-score: 10.9)LTXXQ-like (CL0515) DUF4890; Domain of unknown function (DUF4890) (PF16231; HMM-score: 10.3)no clan defined Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 10.1)VBS-like (CL0705) HIP1_clath_bdg; Clathrin-binding domain of Huntingtin-interacting protein 1 (PF16515; HMM-score: 10)ATP_synthase (CL0255) V-ATPase_G_2; Vacuolar (H+)-ATPase G subunit (PF16999; HMM-score: 8.3)no clan defined Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 8.1)CREPT; Cell-cycle alteration and expression-elevated protein in tumour (PF16566; HMM-score: 8)UPF0242; Uncharacterised protein family (UPF0242) N-terminus (PF06785; HMM-score: 7.3)P-loop_NTPase (CL0023) SRPRB; Signal recognition particle receptor beta subunit (PF09439; HMM-score: 6.5)GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 6.5)no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 4.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.349
- Cytoplasmic Membrane Score: 0.0534
- Cell wall & surface Score: 0.022
- Extracellular Score: 0.5756
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005221
- TAT(Tat/SPI): 0.000691
- LIPO(Sec/SPII): 0.001015
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMFNQINNKNELEESYESEKKRIENELQNLNELRHRTRKENERSYDVFQYLKHEMNYSEDAQRKMTRNIEAYEQEINEIIRKQEWKLEEYKEDLKKSYEKQLDKLSD
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]