Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0422 [new locus tag: SAUSA300_RS02260 ]
- pan locus tag?: SAUPAN002150000
- symbol: SAUSA300_0422
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
tlaA2: TslA chaperone and lap secretion-signal protein TlaA2
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0422 [new locus tag: SAUSA300_RS02260 ]
- symbol: SAUSA300_0422
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 473809..474123
- length: 315
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913761 NCBI
- RefSeq: YP_493135 NCBI
- BioCyc: see SAUSA300_RS02260
- MicrobesOnline: 1291937 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGACTCTAATAGAACCAGATATGACCTTAAGAATGCCAGATATAAGTACTACAGTAGAA
ACACTTAATCTCATATCTAAAATGGAAGCGCAAAAAGAAAATATTCGCACAGTTATTGCA
CCTGAACATAAGCATAAATACAAAGATATTGAAAACGGATTAAAAGGTGAAGAAAAAGTA
TTAATTGAACAAATGGCGCAACATTGCGAAGCTTTTAAAGCTAATTTTAAAGGTGCAGCT
CAAGGAGATTGGGTTAAAAGTGCCATGTCTGAGATAGACAGCATTAAGGATGACCTGAAA
AAAATTAATAGCTAA60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0422 [new locus tag: SAUSA300_RS02260 ]
- symbol: SAUSA300_0422
- description: hypothetical protein
- length: 104
- theoretical pI: 5.68422
- theoretical MW: 11788.5
- GRAVY: -0.568269
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108405: hypothetical protein
- PFAM: no clan defined KMP11; Kinetoplastid membrane protein 11 (PF03037; HMM-score: 17)and 2 moreSNARE-fusion (CL0445) V-SNARE; Vesicle transport v-SNARE protein N-terminus (PF05008; HMM-score: 13.6)OB (CL0021) EXOSC1; Exosome component EXOSC1/CSL4 (PF10447; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6058
- Cytoplasmic Membrane Score: 0.0272
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.3668
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011561
- TAT(Tat/SPI): 0.000399
- LIPO(Sec/SPII): 0.001161
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTLIEPDMTLRMPDISTTVETLNLISKMEAQKENIRTVIAPEHKHKYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKKINS
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
- ↑ Stephen R Garrett, Nicole Mietrach, Justin Deme, Alina Bitzer, Yaping Yang, Fatima R Ulhuq, Dorothee Kretschmer, Simon Heilbronner, Terry K Smith, Susan M Lea, Tracy Palmer
A type VII-secreted lipase toxin with reverse domain arrangement.
Nat Commun: 2023, 14(1);8438
[PubMed:38114483] [WorldCat.org] [DOI] (I e)