From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_000093
  • pan locus tag?: SAUPAN000975000
  • symbol: cap8B
  • pan gene symbol?: capB
  • synonym:
  • product: type 8 capsular polysaccharide synthesis protein Cap8B

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_000093
  • symbol: cap8B
  • product: type 8 capsular polysaccharide synthesis protein Cap8B
  • replicon: chromosome
  • strand: +
  • coordinates: 109265..109951
  • length: 687
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGTCAAAAAAGGAAAATACGACAACAACACTATTTGTGTATGAAAAACCAAAATCAACA
    ATTAGTGAAAAGTTTCGAGGTATACGTTCAAACATCATGTTTTCAAAAGCAAATGGTGAA
    GTAAAGCGCTTATTGGTTACTTCTGAAAAGCCTGGTGCAGGTAAAAGTACAGTTGTATCG
    AATGTAGCGATTACTTATGCACAAGCAGGCTATAAGACATTAGTTATTGATGGCGATATG
    CGTAAGCCAACACAAAACTATATTTTTAATGAGCAAAATAATAATGGACTATCAAGCTTA
    ATCATTGGTCGAACGACTATGTCAGAAGCAATTACGTCGACAGAAATTGAAAATTTAGAT
    TTGCTAACAGCTGGCCCTGTACCTCCAAATCCATCTGAGTTAATAGCTTCAGAAAGGTTT
    AAAGAATTAGTTGATCTGTTTAATAAACGTTACGACATTATTATTGTCGATACACCGCCA
    GTTAATACTGTGACTGATGCACAACTATATGCGCGTGCTATTAAAGATAGTTTGTTAGTA
    ATTGATAGTGAAAAAAATGATAAAAATGAAGTTAAAAAAGCAAAAGCACTTATGGAAAAA
    GCAGGCAGTAACATTCTAGGTGTCATTTTGAACAAGACAAAGGTCGATAAATCTTCTAGT
    TATTATCACTATTATGGAGATGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    687

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_000093
  • symbol: Cap8B
  • description: type 8 capsular polysaccharide synthesis protein Cap8B
  • length: 228
  • theoretical pI: 9.3191
  • theoretical MW: 25298.7
  • GRAVY: -0.411404

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids capsular exopolysaccharide family (TIGR01007; HMM-score: 313)
    and 19 more
    chain length determinant protein tyrosine kinase EpsG (TIGR03029; HMM-score: 149.6)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids exopolysaccharide transport protein family (TIGR01005; HMM-score: 127.2)
    exopolysaccharide/PEP-CTERM locus tyrosine autokinase (TIGR03018; EC 2.7.10.2; HMM-score: 123.9)
    cell division ATPase MinD (TIGR01969; HMM-score: 62.7)
    Cellular processes Cellular processes Cell division septum site-determining protein MinD (TIGR01968; HMM-score: 43.3)
    Hypothetical proteins Conserved transport-energizing ATPase, TRC40/GET3/ArsA family (TIGR00345; EC 3.6.1.-; HMM-score: 24.5)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides cellulose synthase operon protein YhjQ (TIGR03371; HMM-score: 21.9)
    Metabolism Central intermediary metabolism Nitrogen fixation nitrogenase iron protein (TIGR01287; EC 1.18.6.1; HMM-score: 20.7)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 19.8)
    helicase/secretion neighborhood CpaE-like protein (TIGR03815; HMM-score: 17.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.8)
    Signal transduction Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.8)
    signal recognition particle protein SRP54 (TIGR01425; HMM-score: 14.2)
    Metabolism Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 13.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein (TIGR01281; EC 1.3.7.7; HMM-score: 13.5)
    arsenical pump-driving ATPase (TIGR04291; EC 3.6.1.-; HMM-score: 13.1)
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions phage replicative helicase, DnaB family (TIGR03600; HMM-score: 13)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking signal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 12.7)
    Metabolism Energy metabolism Photosynthesis chlorophyllide reductase iron protein subunit X (TIGR02016; HMM-score: 11.9)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    P-loop_NTPase (CL0023) AAA_31; AAA domain (PF13614; HMM-score: 60)
    and 19 more
    ParA; NUBPL iron-transfer P-loop NTPase (PF10609; HMM-score: 47.7)
    CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 38.6)
    MipZ; ATPase MipZ (PF09140; HMM-score: 38.3)
    ArsA_ATPase; Anion-transporting ATPase (PF02374; HMM-score: 24.5)
    AAA_26; AAA domain (PF13500; HMM-score: 20.5)
    MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 19.7)
    Fer4_NifH; 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family (PF00142; HMM-score: 19.5)
    SRP54; SRP54-type protein, GTPase domain (PF00448; HMM-score: 19.5)
    nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 16.7)
    nSTAND_NTPase7; Novel STAND NTPase 7 (PF24404; HMM-score: 15.2)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 14.7)
    Helicase_C; Helicase conserved C-terminal domain (PF00271; HMM-score: 14.3)
    no clan defined AFOR_N; Aldehyde ferredoxin oxidoreductase, N-terminal domain (PF02730; HMM-score: 13.7)
    P-loop_NTPase (CL0023) APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 13.1)
    CLP1_P; mRNA cleavage and polyadenylation factor CLP1 P-loop (PF16575; HMM-score: 13)
    no clan defined UvrA_inter; UvrA interaction domain (PF17760; HMM-score: 12.9)
    P-loop_NTPase (CL0023) NPHP3_N; Nephrocystin 3, N-terminal (PF24883; HMM-score: 12.9)
    KTI12; Chromatin associated protein KTI12 (PF08433; HMM-score: 12.8)
    AAA_30; AAA domain (PF13604; HMM-score: 12.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.99
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7432
    • Cytoplasmic Membrane Score: 0.2123
    • Cell wall & surface Score: 0.001
    • Extracellular Score: 0.0435
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.021296
    • TAT(Tat/SPI): 0.003623
    • LIPO(Sec/SPII): 0.002909
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIASERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulators: CodY (repression) regulon, SigB (activation) regulon
    CodY(TF)important in Amino acid metabolism;  regulation predicted or transferred from N315 and NCTC 8325  [2]
    SigB(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  regulation predicted or transferred from N315 and NCTC 8325  [3] [4] [5]   other strains

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)
  3. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  4. ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  5. ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=JSNZ_000093&oldid=105734"