Navigation

  • Main page
  • Downloads
  • Getting Started
  • Recent changes
  • Random page
  • What links here
  • Related changes
  • Special pages
  • Printable version
  • Permanent link
  • Page information

personal-loginout

  • Log in
  • Not logged in
  • Talk
  • Contributions
  • Create account

Search

?

Navigation menu

Namespaces
  • Page
  • Discussion
English
From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Views
  • Read
  • Edit
  • History
  • Edit source

⊟Summary[edit | edit source]

Contents

  • 1 Summary
  • 2 Genome View
  • 3 Gene
    • 3.1 General
    • 3.2 Accession numbers
    • 3.3 Phenotype
    • 3.4 DNA sequence
  • 4 Protein
    • 4.1 General
    • 4.2 Function
    • 4.3 Structure, modifications & cofactors
    • 4.4 Localization
    • 4.5 Accession numbers
    • 4.6 Protein sequence
    • 4.7 Experimental data
  • 5 Expression & Regulation
    • 5.1 Operon
    • 5.2 Regulation
    • 5.3 Transcription pattern
    • 5.4 Protein synthesis (provided by Aureolib)
    • 5.5 Protein stability
  • 6 Biological Material
    • 6.1 Mutants
    • 6.2 Expression vector
    • 6.3 lacZ fusion
    • 6.4 GFP fusion
    • 6.5 two-hybrid system
    • 6.6 FLAG-tag construct
    • 6.7 Antibody
  • 7 Other Information
  • 8 Literature
    • 8.1 References
    • 8.2 Relevant publications
  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS10985 [old locus tag: SA1909 ]
  • pan locus tag?: SAUPAN005398000
  • symbol: SA_RS10985
  • pan gene symbol?: atpF
  • synonym:
  • product: ATP synthase subunit B

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS10985 [old locus tag: SA1909 ]
  • symbol: SA_RS10985
  • product: ATP synthase subunit B
  • replicon: chromosome
  • strand: -
  • coordinates: 2159999..2160520
  • length: 522
  • essential: yes [1] DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (2159999..2160520) NCBI
  • BioCyc: SA_RS10985 BioCyc
  • MicrobesOnline: see SA1909

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    GTGACTGAAACAGCTAACTTATTCGTTCTTGGTGCAGCTGGAGGCGTTGAGTGGGGTACT
    GTGATTGTACAGGTCCTAACTTTCATCGTGTTACTTGCGTTACTTAAAAAGTTCGCATGG
    GGTCCATTGAAAGATGTAATGGATAAACGTGAAAGAGATATTAACAGAGATATCGATGAC
    GCAGAACAAGCTAAGTTAAATGCACAGAAACTTGAAGAAGAAAATAAACAAAAACTTAAA
    GAAACACAAGAAGAAGTTCAAAAGATTTTAGAAGATGCTAAGGTTCAAGCACGTCAACAG
    CAAGAACAAATTATTCATGAAGCAAACGTACGTGCAAACGGTATGATTGAAACAGCACAA
    AGTGAAATCAATAGCCAAAAAGAACGTGCCATTGCAGATATTAATAATCAAGTATCTGAA
    CTATCAGTGTTAATTGCTTCTAAAGTTCTTAGAAAAGAAATTTCTGAACAAGACCAAAAA
    GCATTGGTTGACAAGTATCTAAAAGAGGCAGGCGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    522

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS10985 [old locus tag: SA1909 ]
  • symbol: SA_RS10985
  • description: ATP synthase subunit B
  • length: 173
  • theoretical pI: 4.75697
  • theoretical MW: 19539.1
  • GRAVY: -0.514451

⊟Function[edit | edit source]

  • ⊞TIGRFAM:
    Metabolism Energy metabolism ATP-proton motive force interconversion ATP synthase F0, B subunit (TIGR01144; EC 3.6.3.14; HMM-score: 124.4)
    and 7 more
    alternate F1F0 ATPase, F0 subunit B (TIGR03321; EC 3.6.3.-; HMM-score: 76)
    hydroxylamine oxidation protein HaoB (TIGR04392; HMM-score: 13.5)
    ATP synthase archaeal, H subunit (TIGR02926; EC 3.6.3.14; HMM-score: 12.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 7.3)
    two transmembrane protein (TIGR04527; HMM-score: 7)
    alternate F1F0 ATPase, F1 subunit alpha (TIGR03324; EC 3.6.3.-; HMM-score: 6.2)
    Metabolism Transport and binding proteins Cations and iron carrying compounds sodium/hydrogen antiporter (TIGR00844; HMM-score: 4.8)
  • TheSEED: see SA1909
  • ⊞PFAM:
    ATP_synthase (CL0255) ATP-synt_B; ATP synthase B/B' CF(0) (PF00430; HMM-score: 107.3)
    and 9 more
    Mt_ATP-synt_B; Mitochondrial ATP synthase B chain precursor (ATP-synt_B) (PF05405; HMM-score: 22)
    GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 18.2)
    no clan defined DivIVA; DivIVA protein (PF05103; HMM-score: 14.3)
    FAM222A; Protein family of FAM222A (PF15258; HMM-score: 13.5)
    RapA_C; RNA polymerase recycling family C-terminal (PF12137; HMM-score: 10.2)
    Piezo_TM1-24; Piezo TM1-24 (PF24871; HMM-score: 8.7)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 8.4)
    no clan defined YfcL; YfcL protein (PF08891; HMM-score: 8.3)
    UBA (CL0214) HBS1_N; HBS1 N-terminus (PF08938; HMM-score: 8.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helix: 1
  • ⊞DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9981
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0019
  • LocateP:
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005976
    • TAT(Tat/SPI): 0.00052
    • LIPO(Sec/SPII): 0.002479
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

  • GI: 446062824 NCBI
  • RefSeq: WP_000140679 NCBI
  • UniProt: see SA1909

⊟Protein sequence[edit | edit source]

  • MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

  • Aureolib: no data available

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
    A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
    Mol Microbiol: 2002, 43(6);1387-400
    [PubMed:11952893] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA_RS10985&oldid=100406"
  • This page was last edited on 11 March 2016, at 13:03.
  • Privacy and Cookies
  • About AureoWiki
  • Imprint
We use Matomo for user statistics and cookies. Privacy and Cookies X
CancelTry again