Navigation

  • Main page
  • Downloads
  • Getting Started
  • Recent changes
  • Random page
  • What links here
  • Related changes
  • Special pages
  • Printable version
  • Permanent link
  • Page information

personal-loginout

  • Log in
  • Not logged in
  • Talk
  • Contributions
  • Create account

Search

?

Navigation menu

Namespaces
  • Page
  • Discussion
English
From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Views
  • Read
  • Edit
  • History
  • Edit source

⊟Summary[edit | edit source]

Contents

  • 1 Summary
  • 2 Genome View
  • 3 Gene
    • 3.1 General
    • 3.2 Accession numbers
    • 3.3 Phenotype
    • 3.4 DNA sequence
  • 4 Protein
    • 4.1 General
    • 4.2 Function
    • 4.3 Structure, modifications & cofactors
    • 4.4 Localization
    • 4.5 Accession numbers
    • 4.6 Protein sequence
    • 4.7 Experimental data
  • 5 Expression & Regulation
    • 5.1 Operon
    • 5.2 Regulation
    • 5.3 Transcription pattern
    • 5.4 Protein synthesis (provided by Aureolib)
    • 5.5 Protein stability
  • 6 Biological Material
    • 6.1 Mutants
    • 6.2 Expression vector
    • 6.3 lacZ fusion
    • 6.4 GFP fusion
    • 6.5 two-hybrid system
    • 6.6 FLAG-tag construct
    • 6.7 Antibody
  • 7 Other Information
  • 8 Literature
    • 8.1 References
    • 8.2 Relevant publications
  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1565 [new locus tag: SACOL_RS07970 ]
  • pan locus tag?: SAUPAN004075000
  • symbol: argR
  • pan gene symbol?: argR
  • synonym: ahrC
  • product: arginine repressor

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1565 [new locus tag: SACOL_RS07970 ]
  • symbol: argR
  • product: arginine repressor
  • replicon: chromosome
  • strand: -
  • coordinates: 1601801..1602253
  • length: 453
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID: 3237573 NCBI
  • RefSeq: YP_186406 NCBI
  • BioCyc: see SACOL_RS07970
  • MicrobesOnline: 913014 MicrobesOnline

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    GTGCCCAAAAAATCGGTTAGGCATATAAAAATTAGAGAAATTATTTCAAATGAACAGATA
    GAGACACAAGATGAATTAGTTAAACGATTAAACGATTATGATTTAAATGTCACTCAAGCA
    ACTGTTTCTCGTGATATTAAAGAACTACAACTTATTAAAGTACCTATACCTTCAGGTCAA
    TATGTTTATAGTTTACCAAATGATAGAAAATTCCATCCTTTAGAAAAATTGGGACGTTAT
    TTAATGGATTCCTTTGTTAATATAGATGGTACTGATAATTTACTTGTTCTAAAAACATTA
    CCTGGTAATGCACAATCTATTGGAGCTATATTAGACCAAATCAATTGGGAAGAAGTACTA
    GGCACAATTTGTGGTGATGATACTTGTTTAATTATTTGTCGAAGCAAAGAGGCAAGTGAT
    GAAATCAAGTCAAGAATTTTCAATTTGTTATAA
    60
    120
    180
    240
    300
    360
    420
    453

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1565 [new locus tag: SACOL_RS07970 ]
  • symbol: ArgR
  • description: arginine repressor
  • length: 150
  • theoretical pI: 5.28159
  • theoretical MW: 17097.6
  • GRAVY: -0.267333

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Amino acid biosynthesis Glutamate family arginine repressor (TIGR01529; HMM-score: 169.8)
    Signal transduction Regulatory functions DNA interactions arginine repressor (TIGR01529; HMM-score: 169.8)
  • ⊞TheSEED  :
    • Arginine pathway regulatory protein ArgR, repressor of arg regulon
    Amino Acids and Derivatives Arginine; urea cycle, polyamines Arginine and Ornithine Degradation  Arginine pathway regulatory protein ArgR, repressor of arg regulon
    and 2 more
    Amino Acids and Derivatives Arginine; urea cycle, polyamines Arginine Biosynthesis extended  Arginine pathway regulatory protein ArgR, repressor of arg regulon
    Amino Acids and Derivatives Arginine; urea cycle, polyamines Arginine Deiminase Pathway  Arginine pathway regulatory protein ArgR, repressor of arg regulon
  • ⊞PFAM:
    HTH (CL0123) Arg_repressor; Arginine repressor, DNA binding domain (PF01316; HMM-score: 95)
    Arg_repressor_C (CL0738) Arg_repressor_C; Arginine repressor, C-terminal domain (PF02863; HMM-score: 93.3)
    and 2 more
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 16.9)
    HTH_1; Bacterial regulatory helix-turn-helix protein, lysR family (PF00126; HMM-score: 11.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effector: Arginine
  • ⊞genes regulated by ArgR/AhrC, TF important in Arginine biosynthesis, Arginine degradationRegPrecise
    repression
    argB < argJ < argC < rocD1
    rocD
    argH < argG
    recN < argR
    glnQ* < glnP*
    cudT
    arcR* < arcC2 < arcD < arcB2 < arcA
    transcription units transferred from N315 data RegPrecise

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • ⊞DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9713
    • Cytoplasmic Membrane Score: 0.0137
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0149
  • ⊞LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003318
    • TAT(Tat/SPI): 0.000875
    • LIPO(Sec/SPII): 0.000397
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI: 57650477 NCBI
  • RefSeq: YP_186406 NCBI
  • UniProt: Q5HFQ1 UniProt

⊟Protein sequence[edit | edit source]

  • MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDEIKSRIFNLL

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 867 [4]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

  • MicrobesOnline: recN < argR

⊟Regulation[edit | edit source]

  • ⊞regulator: ArgR/AhrC (repression) regulon
    ArgR/AhrC(TF)important in Arginine biosynthesis, Arginine degradation; RegPrecise 

⊟Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

  • Aureolib:
    aureolib

⊟Protein stability[edit | edit source]

  • half-life: 32.21 h [5]

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL1565&oldid=78488"
  • This page was last edited on 11 March 2016, at 01:00.
  • Privacy and Cookies
  • About AureoWiki
  • Imprint
We use Matomo for user statistics and cookies. Privacy and Cookies X
CancelTry again