Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02283
- pan locus tag?: SAUPAN005305000
- symbol: SAOUHSC_02283
- pan gene symbol?: ilvH
- synonym: JSNZ_002011
- product: acetolactate synthase 1 regulatory subunit
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02283
- symbol: SAOUHSC_02283
- product: acetolactate synthase 1 regulatory subunit
- replicon: chromosome
- strand: +
- coordinates: 2115291..2115545
- length: 255
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3919158 NCBI
- RefSeq: YP_500765 NCBI
- BioCyc: G1I0R-2155 BioCyc
- MicrobesOnline: 1290721 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGACAAGAATTCTTAAATTACAAGTTGCGGATCAAGTCAGCACGCTAAATCGAATTACA
AGTGCTTTTGTTCGCCTACAATATAATATCGATACATTACATGTTACACATTCTGAACAA
CCTGGGATTTCTAACATGGAAATTCAAGTCGATATTCAAGATGATACATCACTTCATATA
TTAATTAAAAAATTAAAACAACAAATTAATGTTTTAACGGTTGAATGCTACGACCTTGTT
GATAACGAAGCTTAA60
120
180
240
255
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02283
- symbol: SAOUHSC_02283
- description: acetolactate synthase 1 regulatory subunit
- length: 84
- theoretical pI: 4.96128
- theoretical MW: 9620.96
- GRAVY: -0.114286
⊟Function[edit | edit source]
- TIGRFAM: Amino acid biosynthesis Pyruvate family acetolactate synthase, small subunit (TIGR00119; EC 2.2.1.6; HMM-score: 48)and 4 moreCellular processes Adaptations to atypical conditions RelA/SpoT family protein (TIGR00691; HMM-score: 19.3)Amino acid biosynthesis Serine family phosphoglycerate dehydrogenase (TIGR01327; EC 1.1.1.95; HMM-score: 14.2)Energy metabolism Amino acids and amines L-serine dehydratase, iron-sulfur-dependent, beta subunit (TIGR00719; EC 4.3.1.17; HMM-score: 12.9)Energy metabolism Glycolysis/gluconeogenesis L-serine dehydratase, iron-sulfur-dependent, beta subunit (TIGR00719; EC 4.3.1.17; HMM-score: 12.9)
- TheSEED :
- Acetolactate synthase small subunit (EC 2.2.1.6)
Amino Acids and Derivatives Branched-chain amino acids Branched-Chain Amino Acid Biosynthesis Acetolactate synthase small subunit (EC 2.2.1.6)and 1 more - PFAM: ACT (CL0070) ACT_AHAS_ss; AHAS small subunit-like ACT domain (PF22629; HMM-score: 36.9)ACT_4; ACT domain (PF13291; HMM-score: 30.8)and 2 moreACT; ACT domain (PF01842; HMM-score: 26.2)ACT_5; ACT domain (PF13710; HMM-score: 23)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8912
- Cytoplasmic Membrane Score: 0.0661
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0426
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002856
- TAT(Tat/SPI): 0.000349
- LIPO(Sec/SPII): 0.00056
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTRILKLQVADQVSTLNRITSAFVRLQYNIDTLHVTHSEQPGISNMEIQVDIQDDTSLHILIKKLKQQINVLTVECYDLVDNEA
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- predicted SigA promoter [3] : S883 > S884 > SAOUHSC_02281 > SAOUHSC_02282 > SAOUHSC_02283 > S885 > SAOUHSC_02284 > SAOUHSC_02285 > SAOUHSC_02286 > SAOUHSC_02287 > leuD > SAOUHSC_02289
⊟Regulation[edit | edit source]
- regulator: CodY*/JSNZ_001225 (repression) regulon
CodY*/JSNZ_001225 (TF) important in Amino acid metabolism; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e) - ↑ Charlotte D Majerczyk, Paul M Dunman, Thanh T Luong, Chia Y Lee, Marat R Sadykov, Greg A Somerville, Kip Bodi, Abraham L Sonenshein
Direct targets of CodY in Staphylococcus aureus.
J Bacteriol: 2010, 192(11);2861-77
[PubMed:20363936] [WorldCat.org] [DOI] (I p)
