Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02233
- pan locus tag?: SAUPAN005126000
- symbol: SAOUHSC_02233
- pan gene symbol?: —
- synonym:
- product: phi PVL orf 32-like protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02233
- symbol: SAOUHSC_02233
- product: phi PVL orf 32-like protein
- replicon: chromosome
- strand: -
- coordinates: 2070824..2071084
- length: 261
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 3919655 NCBI
- RefSeq: YP_500717 NCBI
- BioCyc: G1I0R-2109 BioCyc
- MicrobesOnline: 1290673 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGAACAAATCACGTTAACCAAAGAAGAGTGTGTCGAACAATGCATCAATAAAGACTTA
AAACTTTTAGATTATCGAGTTCAACAAATTTTAGAAGGTGTTCTATCAGAAAGTACCACA
TACGGTGATGCAAGAAATAAATTAGAAACATTGAAAATTATTGCTGAATCTCATTTTAAA
ACCGAACATGCTTCAGTTATTTACAAATTAGCATTGAAAAAGTTAGACGAAAAAATCAAC
GCCACTCCAATTAAAGAGTGA60
120
180
240
261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02233
- symbol: SAOUHSC_02233
- description: phi PVL orf 32-like protein
- length: 86
- theoretical pI: 5.7472
- theoretical MW: 9893.38
- GRAVY: -0.423256
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002875
- TAT(Tat/SPI): 0.000169
- LIPO(Sec/SPII): 0.000477
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEQITLTKEECVEQCINKDLKLLDYRVQQILEGVLSESTTYGDARNKLETLKIIAESHFKTEHASVIYKLALKKLDEKINATPIKE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- predicted SigA promoter [1] : SAOUHSC_02219 < SAOUHSC_02220 < SAOUHSC_02221 < SAOUHSC_02222 < SAOUHSC_02223 < SAOUHSC_02224 < SAOUHSC_02225 < S859 < SAOUHSC_02227 < SAOUHSC_02228 < SAOUHSC_02229 < S861 < SAOUHSC_02233 < SAOUHSC_02234
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [1]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)