From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00121
  • pan locus tag?: SAUPAN000982000
  • symbol: SAOUHSC_00121
  • pan gene symbol?: capH
  • synonym:
  • product: capsular polysaccharide biosynthesis protein O-acetyl transferase Cap5H

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00121
  • symbol: SAOUHSC_00121
  • product: capsular polysaccharide biosynthesis protein O-acetyl transferase Cap5H
  • replicon: chromosome
  • strand: +
  • coordinates: 126743..127369
  • length: 627
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAGGATAGCGATTGAAAAGATAATTGGTTTGCTGAAAAACCAGTCCTCTAAAGAATCG
    AATGTTAAGATTCATCGCTTGGCGTATATTACAAACTCAAAATTTGATGGCAATAACTAT
    ATAGATAGATGGTGTAAAATCAGGAATTCTCACATTGGTGAATACAGTTATATTGGATTT
    GGTAGTGATTTTAATAATGTAGAAGTAGGAAGATATTGTTCGATATCTTCGGATGTAAAA
    ATTGGGTTAGGAAAACATCCTACACACTTTTTTAGCTCATCACCGATTTTTTATTCTAAT
    AATAATCCATTTAACATAAAGCAAAAGTTTATAGACTTTAATGACCAACCAAGCCGTACA
    ACAATTAAAAATGATGTGTGGATTGGTGCAAATGTAATTATTATGGATGGTTTAACAATA
    AATACTGGTGCAGTCATAGCAGCCGGCTCAGTTGTTACTAAAAATGTAGGAGCATATGAG
    GTTGTTGGTGGTGTTCCTGCAAAAGTGATTAAGAAGCGATTTGACAATAAAACAATTGAA
    AAACTTTTGGAAAGCAAGTGGTGGGAGAAAACGCCTGACAAACTAAAAGGATTTTCGGTT
    GAATATTTAAATAAAAAGGATACTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    627

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_00121
  • symbol: SAOUHSC_00121
  • description: capsular polysaccharide biosynthesis protein O-acetyl transferase Cap5H
  • length: 208
  • theoretical pI: 10.0346
  • theoretical MW: 23476.7
  • GRAVY: -0.373558

Function[edit | edit source]

  • TIGRFAM:
    phosphonate metabolim protein, transferase hexapeptide repeat family (TIGR03308; HMM-score: 134.3)
    and 13 more
    2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (TIGR03532; EC 2.3.1.89; HMM-score: 62.7)
    sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family (TIGR03570; HMM-score: 43.7)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 37.8)
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 37.8)
    Metabolism Central intermediary metabolism Amino sugars UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 37.8)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD (TIGR01853; EC 2.3.1.191; HMM-score: 32.5)
    glucose-1-phosphate thymidylyltransferase (TIGR01208; EC 2.7.7.24; HMM-score: 31.6)
    Metabolism Amino acid biosynthesis Serine family serine O-acetyltransferase (TIGR01172; EC 2.3.1.30; HMM-score: 30.4)
    colanic acid biosynthesis acetyltransferase WcaF (TIGR04008; EC 2.3.1.-; HMM-score: 29.4)
    Metabolism Energy metabolism Other phenylacetic acid degradation protein PaaY (TIGR02287; HMM-score: 22.7)
    colanic acid biosynthesis acetyltransferase WcaB (TIGR04016; EC 2.3.1.-; HMM-score: 22.3)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase (TIGR01852; EC 2.3.1.129; HMM-score: 18)
    UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03992; EC 2.3.1.157,2.7.7.23; HMM-score: 11)
  • TheSEED  :
    • Capsular polysaccharide synthesis enzyme Cap5H
    • O-acetyl transferase
  • PFAM:
    HEXAPEP (CL0536) Hexapep; Bacterial transferase hexapeptide (six repeats) (PF00132; HMM-score: 55.5)
    and 4 more
    LbH_EIF2B; EIF2B subunit epsilon LbH domain (PF25084; HMM-score: 28.6)
    Hexapep_2; Hexapeptide repeat of succinyl-transferase (PF14602; HMM-score: 23)
    Hexapep_GlmU; GlmU-like, C-terminal hexapeptide (PF24894; HMM-score: 16.3)
    DCTN5; Dynactin subunit 5 (PF21711; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9167
    • Cytoplasmic Membrane Score: 0.0195
    • Cell wall & surface Score: 0.0005
    • Extracellular Score: 0.0633
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.055498
    • TAT(Tat/SPI): 0.000935
    • LIPO(Sec/SPII): 0.002957
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRIAIEKIIGLLKNQSSKESNVKIHRLAYITNSKFDGNNYIDRWCKIRNSHIGEYSYIGFGSDFNNVEVGRYCSISSDVKIGLGKHPTHFFSSSPIFYSNNNPFNIKQKFIDFNDQPSRTTIKNDVWIGANVIIMDGLTINTGAVIAAGSVVTKNVGAYEVVGGVPAKVIKKRFDNKTIEKLLESKWWEKTPDKLKGFSVEYLNKKDT

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulators: CodY* (repression) regulon, SigB* (activation) regulon
    CodY*(TF)important in Amino acid metabolism; RegPrecise    transcription unit transferred from N315 data RegPrecise 
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [6] [3]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. 3.0 3.1 3.2 3.3 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)
  4. Daniela Keinhörster, Shilpa Elizabeth George, Christopher Weidenmaier, Christiane Wolz
    Function and regulation of Staphylococcus aureus wall teichoic acids and capsular polysaccharides.
    Int J Med Microbiol: 2019, 309(6);151333
    [PubMed:31362856] [WorldCat.org] [DOI] (I p)
  5. S Sau, J Sun, C Y Lee
    Molecular characterization and transcriptional analysis of type 8 capsule genes in Staphylococcus aureus.
    J Bacteriol: 1997, 179(5);1614-21
    [PubMed:9045821] [WorldCat.org] [DOI] (P p)
  6. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit | edit source]