From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2174 [new locus tag: SACOL_RS11440 ]
  • pan locus tag?: SAUPAN005579000
  • symbol: SACOL2174
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2174 [new locus tag: SACOL_RS11440 ]
  • symbol: SACOL2174
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2256018..2256257
  • length: 240
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGCTAACAATCATAACCAAAACGGACAAGACTCTACACAACAAGTGATTAATTTTTTA
    AAAGTATTTAAATGGAGAATCGTTGGTTTCCTAGCGTTTCTATTAATCGCGATATTATTC
    TTAACGTTAGGTTTTTGGAAAACAGTACTTATCATCGTTTTATGTTTAATTGGTGTAGGT
    ATTGGGTATATGAAAGACCGTAAGCAAGATTTTATGAATTTTTTAAATCGATGGAGTTAA
    60
    120
    180
    240

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL2174 [new locus tag: SACOL_RS11440 ]
  • symbol: SACOL2174
  • description: hypothetical protein
  • length: 79
  • theoretical pI: 10.6864
  • theoretical MW: 9222.96
  • GRAVY: 0.508861

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein modification and repair apolipoprotein N-acyltransferase (TIGR00546; EC 2.3.1.-; HMM-score: 15.1)
  • TheSEED  :
    • Hypothetical protein SAV2183
  • PFAM:
    no clan defined DUF2273; Small integral membrane protein (DUF2273) (PF10031; HMM-score: 50.9)
    and 7 more
    TMEM82; Transmembrane protein 82 (PF15816; HMM-score: 16.1)
    TrbC_VirB2 (CL0690) TrbC; TrbC/VIRB2 pilin (PF04956; HMM-score: 14.1)
    no clan defined DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 13.5)
    DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 13.3)
    DUF4381; Domain of unknown function (DUF4381) (PF14316; HMM-score: 12.3)
    Dynamin-like_hel_bact; Bacterial dynamin-like protein, helical domain (PF21808; HMM-score: 11.7)
    DUF2530; Protein of unknown function (DUF2530) (PF10745; HMM-score: 10.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9994
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0006
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00169
    • TAT(Tat/SPI): 0.000218
    • LIPO(Sec/SPII): 0.018319
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MANNHNQNGQDSTQQVINFLKVFKWRIVGFLAFLLIAILFLTLGFWKTVLIIVLCLIGVGIGYMKDRKQDFMNFLNRWS

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Integral membrane [1] [2] [3]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [4] [5]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  5. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)

Relevant publications[edit | edit source]