Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2174 [new locus tag: SACOL_RS11440 ]
- pan locus tag?: SAUPAN005579000
- symbol: SACOL2174
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2174 [new locus tag: SACOL_RS11440 ]
- symbol: SACOL2174
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2256018..2256257
- length: 240
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237406 NCBI
- RefSeq: YP_186985 NCBI
- BioCyc: see SACOL_RS11440
- MicrobesOnline: 913659 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGCTAACAATCATAACCAAAACGGACAAGACTCTACACAACAAGTGATTAATTTTTTA
AAAGTATTTAAATGGAGAATCGTTGGTTTCCTAGCGTTTCTATTAATCGCGATATTATTC
TTAACGTTAGGTTTTTGGAAAACAGTACTTATCATCGTTTTATGTTTAATTGGTGTAGGT
ATTGGGTATATGAAAGACCGTAAGCAAGATTTTATGAATTTTTTAAATCGATGGAGTTAA60
120
180
240
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2174 [new locus tag: SACOL_RS11440 ]
- symbol: SACOL2174
- description: hypothetical protein
- length: 79
- theoretical pI: 10.6864
- theoretical MW: 9222.96
- GRAVY: 0.508861
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein modification and repair apolipoprotein N-acyltransferase (TIGR00546; EC 2.3.1.-; HMM-score: 15.1)
- TheSEED :
- Hypothetical protein SAV2183
- PFAM: no clan defined DUF2273; Small integral membrane protein (DUF2273) (PF10031; HMM-score: 50.9)and 7 moreTMEM82; Transmembrane protein 82 (PF15816; HMM-score: 16.1)TrbC_VirB2 (CL0690) TrbC; TrbC/VIRB2 pilin (PF04956; HMM-score: 14.1)no clan defined DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 13.5)DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 13.3)DUF4381; Domain of unknown function (DUF4381) (PF14316; HMM-score: 12.3)Dynamin-like_hel_bact; Bacterial dynamin-like protein, helical domain (PF21808; HMM-score: 11.7)DUF2530; Protein of unknown function (DUF2530) (PF10745; HMM-score: 10.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9994
- Cell wall & surface Score: 0
- Extracellular Score: 0.0006
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00169
- TAT(Tat/SPI): 0.000218
- LIPO(Sec/SPII): 0.018319
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MANNHNQNGQDSTQQVINFLKVFKWRIVGFLAFLLIAILFLTLGFWKTVLIIVLCLIGVGIGYMKDRKQDFMNFLNRWS
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Integral membrane [1] [2] [3]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB* (activation) regulon
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p)