From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2175 [new locus tag: SACOL_RS11445 ]
  • pan locus tag?: SAUPAN005580000
  • symbol: SACOL2175
  • pan gene symbol?: amaP
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2175 [new locus tag: SACOL_RS11445 ]
  • symbol: SACOL2175
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2256270..2256818
  • length: 549
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    GTGTCGTTAGGGGTGAAACGACTTAAAAACTTTATCCTTGGCTTATTAATAGTAGTAATC
    GTGGGGTTCCTGTTATTCATGTATATCCAAGATGGACGTATAACTGAATATCAAGACTAC
    TTCCTTCAATTTGAATGGTTCCAACCATTACTTATTTCACTTGCTGCACTATTGATATTA
    ATAGGTCTTATATTAGTATTTAGTATCTTCAAACCTACGCATCGAAAACCTGGATTATAC
    AAAGACTTCGATGATGGTCATGTTTACGTATCTCGTAAAGCTGTTGAAAAGACGGCATTC
    GATACGGTTGCAAAATATGATCAAGTAAGACAACCAAATGTAGTTGCGAAACTATATAAC
    AAAAAAAATAAATCTTATATCGACATTAAAACTGACTTTTTCGTACCAAATAATGTTCAA
    GTTCAATCTTTAACTGAAGCAATTCGTTCGGATATTAAAAAGAATGTAGAATATTTCACA
    GAAATGCCAGTACGTAAGTTAGAAGTTAATGTGAGAGATCAGAAAACTTCTGGTCCACGA
    GTGTTGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    549


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL2175 [new locus tag: SACOL_RS11445 ]
  • symbol: SACOL2175
  • description: hypothetical protein
  • length: 182
  • theoretical pI: 10.0687
  • theoretical MW: 21156.7
  • GRAVY: 0.0373626

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Hypothetical protein SAV2184
  • PFAM:
    no clan defined Asp23; Asp23 family, cell envelope-related function (PF03780; HMM-score: 19.7)
    and 9 more
    DUF6057; Family of unknown function (DUF6057) (PF19529; HMM-score: 15.7)
    LysE (CL0292) SfLAP; Sap, sulfolipid-1-addressing protein (PF11139; HMM-score: 14.5)
    no clan defined DUF3098; Protein of unknown function (DUF3098) (PF11297; HMM-score: 14.3)
    TPR (CL0020) Fis1_TPR_C; Fis1 C-terminal tetratricopeptide repeat (PF14853; HMM-score: 12.3)
    BPD_transp_1 (CL0404) FtsX; FtsX-like permease C-terminal (PF02687; HMM-score: 11.8)
    no clan defined DUF997; Protein of unknown function (DUF997) (PF06196; HMM-score: 10.5)
    FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 10)
    Pox_EPC_I2-L1; Poxvirus entry protein complex L1 and I2 (PF12575; HMM-score: 7.9)
    FtsH_ext; FtsH Extracellular (PF06480; HMM-score: 7.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9941
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0059
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003557
    • TAT(Tat/SPI): 0.000164
    • LIPO(Sec/SPII): 0.023503
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSLGVKRLKNFILGLLIVVIVGFLLFMYIQDGRITEYQDYFLQFEWFQPLLISLAALLILIGLILVFSIFKPTHRKPGLYKDFDDGHVYVSRKAVEKTAFDTVAKYDQVRQPNVVAKLYNKKNKSYIDIKTDFFVPNNVQVQSLTEAIRSDIKKNVEYFTEMPVRKLEVNVRDQKTSGPRVL

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Integral membrane [1] [2] [3]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [4] [5]   other strains

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: 15.97 h [6]

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  5. ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  6. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Marret Müller, Swantje Reiß, Rabea Schlüter, Ulrike Mäder, Anica Beyer, Wenke Reiß, Jon Marles-Wright, Richard J Lewis, Henrike Pförtner, Uwe Völker, Katharina Riedel, Michael Hecker, Susanne Engelmann, Jan Pané-Farré
Deletion of membrane-associated Asp23 leads to upregulation of cell wall stress genes in Staphylococcus aureus.
Mol Microbiol: 2014, 93(6);1259-68
[PubMed:25074408] [WorldCat.org] [DOI] (I p)