Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2175 [new locus tag: SACOL_RS11445 ]
- pan locus tag?: SAUPAN005580000
- symbol: SACOL2175
- pan gene symbol?: amaP
- synonym: JSNZ_002154
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2175 [new locus tag: SACOL_RS11445 ]
- symbol: SACOL2175
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2256270..2256818
- length: 549
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237407 NCBI
- RefSeq: YP_186986 NCBI
- BioCyc: see SACOL_RS11445
- MicrobesOnline: 913660 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541GTGTCGTTAGGGGTGAAACGACTTAAAAACTTTATCCTTGGCTTATTAATAGTAGTAATC
GTGGGGTTCCTGTTATTCATGTATATCCAAGATGGACGTATAACTGAATATCAAGACTAC
TTCCTTCAATTTGAATGGTTCCAACCATTACTTATTTCACTTGCTGCACTATTGATATTA
ATAGGTCTTATATTAGTATTTAGTATCTTCAAACCTACGCATCGAAAACCTGGATTATAC
AAAGACTTCGATGATGGTCATGTTTACGTATCTCGTAAAGCTGTTGAAAAGACGGCATTC
GATACGGTTGCAAAATATGATCAAGTAAGACAACCAAATGTAGTTGCGAAACTATATAAC
AAAAAAAATAAATCTTATATCGACATTAAAACTGACTTTTTCGTACCAAATAATGTTCAA
GTTCAATCTTTAACTGAAGCAATTCGTTCGGATATTAAAAAGAATGTAGAATATTTCACA
GAAATGCCAGTACGTAAGTTAGAAGTTAATGTGAGAGATCAGAAAACTTCTGGTCCACGA
GTGTTGTAA60
120
180
240
300
360
420
480
540
549
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2175 [new locus tag: SACOL_RS11445 ]
- symbol: SACOL2175
- description: hypothetical protein
- length: 182
- theoretical pI: 10.0687
- theoretical MW: 21156.7
- GRAVY: 0.0373626
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Hypothetical protein SAV2184
- PFAM: no clan defined Asp23; Asp23 family, cell envelope-related function (PF03780; HMM-score: 19.7)and 9 moreDUF6057; Family of unknown function (DUF6057) (PF19529; HMM-score: 15.7)LysE (CL0292) SfLAP; Sap, sulfolipid-1-addressing protein (PF11139; HMM-score: 14.5)no clan defined DUF3098; Protein of unknown function (DUF3098) (PF11297; HMM-score: 14.3)TPR (CL0020) Fis1_TPR_C; Fis1 C-terminal tetratricopeptide repeat (PF14853; HMM-score: 12.3)BPD_transp_1 (CL0404) FtsX; FtsX-like permease C-terminal (PF02687; HMM-score: 11.8)no clan defined DUF997; Protein of unknown function (DUF997) (PF06196; HMM-score: 10.5)FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 10)Pox_EPC_I2-L1; Poxvirus entry protein complex L1 and I2 (PF12575; HMM-score: 7.9)FtsH_ext; FtsH Extracellular (PF06480; HMM-score: 7.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9941
- Cell wall & surface Score: 0
- Extracellular Score: 0.0059
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003557
- TAT(Tat/SPI): 0.000164
- LIPO(Sec/SPII): 0.023503
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSLGVKRLKNFILGLLIVVIVGFLLFMYIQDGRITEYQDYFLQFEWFQPLLISLAALLILIGLILVFSIFKPTHRKPGLYKDFDDGHVYVSRKAVEKTAFDTVAKYDQVRQPNVVAKLYNKKNKSYIDIKTDFFVPNNVQVQSLTEAIRSDIKKNVEYFTEMPVRKLEVNVRDQKTSGPRVL
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Integral membrane [1] [2] [3]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB*/JSNZ_002025 (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 15.97 h [6]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Marret Müller, Swantje Reiß, Rabea Schlüter, Ulrike Mäder, Anica Beyer, Wenke Reiß, Jon Marles-Wright, Richard J Lewis, Henrike Pförtner, Uwe Völker, Katharina Riedel, Michael Hecker, Susanne Engelmann, Jan Pané-Farré
Deletion of membrane-associated Asp23 leads to upregulation of cell wall stress genes in Staphylococcus aureus.
Mol Microbiol: 2014, 93(6);1259-68
[PubMed:25074408] [WorldCat.org] [DOI] (I p)