Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1985 [new locus tag: SA_RS11435 ]
- pan locus tag?: SAUPAN005579000
- symbol: SA1985
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1985 [new locus tag: SA_RS11435 ]
- symbol: SA1985
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2256168..2256407
- length: 240
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124901 NCBI
- RefSeq: NP_375296 NCBI
- BioCyc: see SA_RS11435
- MicrobesOnline: 104322 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGCTAACAATCATAACCAAAACGGACAAGACTCTACACAACAAGTGATTAATTTTTTA
AAAGTATTTAAATGGAGAATCGTTGGTTTCCTAGCGTTTCTATTAATCGCGATATTATTC
TTAACGTTAGGTTTTTGGAAAACAGTACTTATCATCGTTTTATGTTTAATTGGTGTAGGT
ATTGGGTATATGAAAGACCGTAAGCAAGATTTTATGAATTTTTTAAATCGATGGAGTTAA60
120
180
240
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1985 [new locus tag: SA_RS11435 ]
- symbol: SA1985
- description: hypothetical protein
- length: 79
- theoretical pI: 10.6864
- theoretical MW: 9222.96
- GRAVY: 0.508861
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein modification and repair apolipoprotein N-acyltransferase (TIGR00546; EC 2.3.1.-; HMM-score: 15.1)
- TheSEED :
- Hypothetical protein SAV2183
- PFAM: no clan defined DUF2273; Small integral membrane protein (DUF2273) (PF10031; HMM-score: 50.9)and 7 moreTMEM82; Transmembrane protein 82 (PF15816; HMM-score: 16.1)TrbC_VirB2 (CL0690) TrbC; TrbC/VIRB2 pilin (PF04956; HMM-score: 14.1)no clan defined DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 13.5)DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 13.3)DUF4381; Domain of unknown function (DUF4381) (PF14316; HMM-score: 12.3)Dynamin-like_hel_bact; Bacterial dynamin-like protein, helical domain (PF21808; HMM-score: 11.7)DUF2530; Protein of unknown function (DUF2530) (PF10745; HMM-score: 10.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9994
- Cell wall & surface Score: 0
- Extracellular Score: 0.0006
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00169
- TAT(Tat/SPI): 0.000218
- LIPO(Sec/SPII): 0.018319
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MANNHNQNGQDSTQQVINFLKVFKWRIVGFLAFLLIAILFLTLGFWKTVLIIVLCLIGVGIGYMKDRKQDFMNFLNRWS
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: asp23 < SA1985 < SA1986
⊟Regulation[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]