Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1697 [new locus tag: SACOL_RS08655 ]
- pan locus tag?: SAUPAN004248000
- symbol: ruvA
- pan gene symbol?: ruvA
- synonym:
- product: Holliday junction DNA helicase RuvA
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1697 [new locus tag: SACOL_RS08655 ]
- symbol: ruvA
- product: Holliday junction DNA helicase RuvA
- replicon: chromosome
- strand: -
- coordinates: 1729800..1730402
- length: 603
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238120 NCBI
- RefSeq: YP_186536 NCBI
- BioCyc: see SACOL_RS08655
- MicrobesOnline: 913145 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGTACGCGTATGTCAAAGGTAAGTTAACACATTTATATCCTACACACGTAGTTGTTGAA
ACTGCTGGTGTTGGTTATGAAATTCAAACACCAAATTCTTATCGTTTTCAAAAGCATCTA
GATCATGAAGTTTTAATTCATACATCTTTAATTGTTCGTGAAGATGCACAATTATTGTAT
GGATTTAGTAGTGAAGAAGAGAAAGATATGTTCTTGAGTTTAATTAAAGTTACTGGTATT
GGTCCGAAATCAGCTTTAGCTATTTTAGCGACAAGTACGCCTAATGAAGTAAAACGTGCC
ATTGAAAATGAAAATGATACGTATTTAACTAAATTCCCAGGAATTGGTAAGAAAACGGCA
AGACAGATTGTCTTAGATTTAAAAGGTAAAGTGAAAATTACTGAAGAAGATAGCGATTCA
TTATTACAAGTAGACGCTACTTCGACGGTGCAAGATCAATTCGTGCAAGAAGCAATGTTA
GCGTTAGAAGCATTAGGTTATTCTAAACGAGAGCTTGCAAAAGTTGAGAAAACGTTAAAT
AAAAATAAATATGACTCAGTTGATGAAGCTGTTAAGGCAGGTCTTCAATTAGTTGTATCT
TAA60
120
180
240
300
360
420
480
540
600
603
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1697 [new locus tag: SACOL_RS08655 ]
- symbol: RuvA
- description: Holliday junction DNA helicase RuvA
- length: 200
- theoretical pI: 6.03453
- theoretical MW: 22262.3
- GRAVY: -0.246
⊟Function[edit | edit source]
- reaction: EC 3.6.4.12? ExPASyDNA helicase ATP + H2O = ADP + phosphate
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair Holliday junction DNA helicase RuvA (TIGR00084; EC 3.6.4.12; HMM-score: 174)and 3 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS13 (TIGR03631; HMM-score: 16.1)Unknown function Enzymes of unknown specificity putative DNA modification/repair radical SAM protein (TIGR03916; HMM-score: 13.8)DNA metabolism DNA replication, recombination, and repair recombination protein RecR (TIGR00615; HMM-score: 12.3)
- TheSEED :
- Holliday junction DNA helicase RuvA
and 1 more - PFAM: OB (CL0021) RuvA_N; RuvA N terminal domain (PF01330; HMM-score: 76)and 11 moreHHH (CL0198) HHH_5; Helix-hairpin-helix domain (PF14520; HMM-score: 55)UBA (CL0214) RuvA_C; RuvA, C-terminal domain (PF07499; HMM-score: 40.4)HHH (CL0198) HHH; Helix-hairpin-helix motif (PF00633; HMM-score: 27.7)IMS_HHH; IMS family HHH motif (PF11798; HMM-score: 23.6)RecR_HhH; RecR, helix-hairpin-helix (PF21176; HMM-score: 23.3)H2TH (CL0303) Ribosomal_S13; Ribosomal protein S13/S18 (PF00416; HMM-score: 20.6)HHH (CL0198) HHH_8; Helix-hairpin-helix domain (PF14716; HMM-score: 17.6)HHH_3; Helix-hairpin-helix motif (PF12836; HMM-score: 15.4)Transposase_20; Transposase IS116/IS110/IS902 family (PF02371; HMM-score: 14)HHH_2; Helix-hairpin-helix motif (PF12826; HMM-score: 14)5_3_exonuc_C (CL0464) 5_3_exonuc; 5'-3' exonuclease, C-terminal SAM fold (PF01367; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9854
- Cytoplasmic Membrane Score: 0.0145
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0001
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003512
- TAT(Tat/SPI): 0.000142
- LIPO(Sec/SPII): 0.001493
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKHLDHEVLIHTSLIVREDAQLLYGFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGKKTARQIVLDLKGKVKITEEDSDSLLQVDATSTVQDQFVQEAMLALEALGYSKRELAKVEKTLNKNKYDSVDEAVKAGLQLVVS
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 103 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 35.6 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
