Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1698 [new locus tag: SACOL_RS08660 ]
- pan locus tag?: SAUPAN004249000
- symbol: SACOL1698
- pan gene symbol?: thrR
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1698 [new locus tag: SACOL_RS08660 ]
- symbol: SACOL1698
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1730416..1730874
- length: 459
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238485 NCBI
- RefSeq: YP_186537 NCBI
- BioCyc: see SACOL_RS08660
- MicrobesOnline: 913146 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGATGGACAATAAAGATTATAAAAAGTTTTATTTAATTAGAGAAGATGTCTTGCCTGAA
TCCGTGGTTAAAACATTGAAGATTAAAGATGCCTTAAAAAGTGATCCGACATTGTCCATT
TATGATGCCGTTAAACAGTTTGATCTATCTAGAAGTGCTTTTTATAAATATAGAGAAACG
ATATTTCCAGTAGACGATAAAATGCTTGACCATCGAGAATTTACATTAATTTTATATGTA
ACTGATATTGTTGGTATGTTGGCACGTGTACTAGATGTTATATCAAAGTTAGAACTATCT
GTATTAACGATTCATCAAAGTATTCCAATGGAAGAAAAAGCAACAATAACATTATCACTG
AATGCTAAATCTAAAGAAACTTCAGTAGAAGATGTTATTGGCGCTTTGAGAAATTTAGAT
TATGTATCAAAAGTAGAATTAATTAGTATGAGTATGTAA60
120
180
240
300
360
420
459
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1698 [new locus tag: SACOL_RS08660 ]
- symbol: SACOL1698
- description: hypothetical protein
- length: 152
- theoretical pI: 5.3108
- theoretical MW: 17474.3
- GRAVY: -0.0151316
⊟Function[edit | edit source]
- TIGRFAM: Amino acid biosynthesis Aspartate family aspartate kinase (TIGR00657; EC 2.7.2.4; HMM-score: 13.1)
- TheSEED :
- ACT domain-containing protein
- PFAM: ACT (CL0070) ACT_4; ACT domain (PF13291; HMM-score: 24.9)ACT; ACT domain (PF01842; HMM-score: 21.5)and 5 morebHLH-TF_ACT-like_plant; Plant bHLH transcription factor, ACT-like domain (PF22754; HMM-score: 19)ACT_5; ACT domain (PF13710; HMM-score: 14.9)no clan defined DUF5896; Family of unknown function (DUF5896) (PF19248; HMM-score: 14.2)ACT (CL0070) ACT_AHAS_ss; AHAS small subunit-like ACT domain (PF22629; HMM-score: 13.3)HTH (CL0123) HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7601
- Cytoplasmic Membrane Score: 0.0444
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.195
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002306
- TAT(Tat/SPI): 0.000148
- LIPO(Sec/SPII): 0.000539
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMDNKDYKKFYLIREDVLPESVVKTLKIKDALKSDPTLSIYDAVKQFDLSRSAFYKYRETIFPVDDKMLDHREFTLILYVTDIVGMLARVLDVISKLELSVLTIHQSIPMEEKATITLSLNAKSKETSVEDVIGALRNLDYVSKVELISMSM
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)