Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1688 [new locus tag: SACOL_RS08610 ]
- pan locus tag?: SAUPAN004238000
- symbol: SACOL1688
- pan gene symbol?: dtd
- synonym:
- product: D-tyrosyl-tRNA(Tyr) deacylase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1688 [new locus tag: SACOL_RS08610 ]
- symbol: SACOL1688
- product: D-tyrosyl-tRNA(Tyr) deacylase
- replicon: chromosome
- strand: -
- coordinates: 1717645..1718097
- length: 453
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238135 NCBI
- RefSeq: YP_186527 NCBI
- BioCyc: see SACOL_RS08610
- MicrobesOnline: 913136 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAAGTAGTTGTACAAAGAGTTAAAGAAGCATCGGTGACGAATGATACATTAAATAAT
CAAATCAAAAAAGGATATTGTTTATTAGTCGGTATCGGTCAGAACTCTACAGAGCAAGAT
GCAGATGTAATTGCAAAGAAAATTGCTAATGCAAGATTATTTGAAGATGACAATAATAAA
TTAAACTTTAATATCCAACAAATGAATGGTGAAATACTATCAGTTTCACAATTTACTCTC
TATGCAGATGTAAAAAAAGGTAACCGTCCAGGTTTCTCAAATTCTAAAAATCCTGATCAA
GCGGTAAAAATTTATGAGTATTTTAATGATGCGCTACGAGCGTATGGTCTTACTGTGAAA
ACAGGTGAATTTGGAACACACATGAATGTTAGCATAAATAATGATGGTCCAGTCACTATT
ATTTATGAAAGTCAGGACGGCAAAATTCAATGA60
120
180
240
300
360
420
453
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1688 [new locus tag: SACOL_RS08610 ]
- symbol: SACOL1688
- description: D-tyrosyl-tRNA(Tyr) deacylase
- length: 150
- theoretical pI: 7.34423
- theoretical MW: 16696.7
- GRAVY: -0.502667
⊟Function[edit | edit source]
- reaction: EC 3.1.1.96? ExPASyD-aminoacyl-tRNA deacylase A D-aminoacyl-tRNA + H2O = a D-amino acid + tRNA Glycyl-tRNA(Ala) + H2O = glycine + tRNA(Ala)?
- TIGRFAM: Protein synthesis tRNA aminoacylation D-tyrosyl-tRNA(Tyr) deacylase (TIGR00256; EC 3.6.1.-; HMM-score: 175.4)
- TheSEED :
- D-aminoacyl-tRNA deacylase (EC 3.1.1.96)
Regulation and Cell signaling Regulation and Cell signaling - no subcategory Stringent Response, (p)ppGpp metabolism D-tyrosyl-tRNA(Tyr) deacylase (EC 3.6.1.n1)and 1 more - PFAM: no clan defined Tyr_Deacylase; D-Tyr-tRNA(Tyr) deacylase (PF02580; HMM-score: 183.3)and 1 moreDUF4828; Domain of unknown function (DUF4828) (PF16110; HMM-score: 13.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.5562
- Cytoplasmic Membrane Score: 0.0199
- Cell wall & surface Score: 0.0016
- Extracellular Score: 0.4223
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.027251
- TAT(Tat/SPI): 0.000323
- LIPO(Sec/SPII): 0.002547
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKVVVQRVKEASVTNDTLNNQIKKGYCLLVGIGQNSTEQDADVIAKKIANARLFEDDNNKLNFNIQQMNGEILSVSQFTLYADVKKGNRPGFSNSKNPDQAVKIYEYFNDALRAYGLTVKTGEFGTHMNVSINNDGPVTIIYESQDGKIQ
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 355 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 14.98 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
