Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1611 [new locus tag: SACOL_RS08215 ]
- pan locus tag?: SAUPAN004135000
- symbol: SACOL1611
- pan gene symbol?: zur
- synonym:
- product: FUR family transcriptional regulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1611 [new locus tag: SACOL_RS08215 ]
- symbol: SACOL1611
- product: FUR family transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 1641975..1642385
- length: 411
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236575 NCBI
- RefSeq: YP_186451 NCBI
- BioCyc: see SACOL_RS08215
- MicrobesOnline: 913060 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAATACAAATGATGCTATTAAAATTTTAAAAGAGAACGGTTTAAAATATACAGATAAA
CGTAAAGATATGTTAGATATTTTTGTCGAAGAAGATAAGTATATAAACGCAAAGTATATA
CAACAAGTTATGGATGAAAATTATCCTGGAATTTCATTCGACACAATATATAGAAACCTG
CACTTATTTAAAGATTTAGGAATTATTGAAAATACAGAACTTGATGGTGAAATGAAGTTT
AGAATCGCTTGTACAAACCATCATCATCATCATTTTATCTGTGAAAAGTGTGGAGATACA
AAGGTAATAGATTATTGTCCAATAGATCAGATAAAATTATCACTACCTGGTGTTAATATT
CACAAACACAAACTTGAAGTTTATGGTGTATGTGAGTCTTGCCAAGATTAA60
120
180
240
300
360
411
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1611 [new locus tag: SACOL_RS08215 ]
- symbol: SACOL1611
- description: FUR family transcriptional regulator
- length: 136
- theoretical pI: 6.07084
- theoretical MW: 15922.1
- GRAVY: -0.516912
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Zinc uptake regulation protein Zur
- PFAM: HTH (CL0123) FUR; Ferric uptake regulator family (PF01475; HMM-score: 114)and 3 moreMJ1010-like_2nd; Uncharacterized ATP-binding protein MJ1010-like, C-terminal domain (PF21690; HMM-score: 14.4)NSUN_ferredox (CL0795) NSUN5_fdxn-like; NOL1/NOP2/Sun domain family member 5, ferredoxin-like domain (PF21148; HMM-score: 13.6)no clan defined F-protein; Negative factor, (F-Protein) or Nef (PF00469; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effector: Zinc ion (Zn2+)
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8523
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0
- Extracellular Score: 0.1475
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002478
- TAT(Tat/SPI): 0.000134
- LIPO(Sec/SPII): 0.000435
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNTNDAIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENYPGISFDTIYRNLHLFKDLGIIENTELDGEMKFRIACTNHHHHHFICEKCGDTKVIDYCPIDQIKLSLPGVNIHKHKLEVYGVCESCQD
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4]
- quantitative data / protein copy number per cell: 242 [5]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: Zur* (repression) regulon
Zur* (TF) important in Zinc homeostasis; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)
