From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1611 [new locus tag: SACOL_RS08215 ]
  • pan locus tag?: SAUPAN004135000
  • symbol: SACOL1611
  • pan gene symbol?: zur
  • synonym:
  • product: FUR family transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1611 [new locus tag: SACOL_RS08215 ]
  • symbol: SACOL1611
  • product: FUR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 1641975..1642385
  • length: 411
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAATACAAATGATGCTATTAAAATTTTAAAAGAGAACGGTTTAAAATATACAGATAAA
    CGTAAAGATATGTTAGATATTTTTGTCGAAGAAGATAAGTATATAAACGCAAAGTATATA
    CAACAAGTTATGGATGAAAATTATCCTGGAATTTCATTCGACACAATATATAGAAACCTG
    CACTTATTTAAAGATTTAGGAATTATTGAAAATACAGAACTTGATGGTGAAATGAAGTTT
    AGAATCGCTTGTACAAACCATCATCATCATCATTTTATCTGTGAAAAGTGTGGAGATACA
    AAGGTAATAGATTATTGTCCAATAGATCAGATAAAATTATCACTACCTGGTGTTAATATT
    CACAAACACAAACTTGAAGTTTATGGTGTATGTGAGTCTTGCCAAGATTAA
    60
    120
    180
    240
    300
    360
    411

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1611 [new locus tag: SACOL_RS08215 ]
  • symbol: SACOL1611
  • description: FUR family transcriptional regulator
  • length: 136
  • theoretical pI: 6.07084
  • theoretical MW: 15922.1
  • GRAVY: -0.516912

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Zinc uptake regulation protein Zur
    Stress Response Oxidative stress Oxidative stress  Zinc uptake regulation protein ZUR
  • PFAM:
    HTH (CL0123) FUR; Ferric uptake regulator family (PF01475; HMM-score: 114)
    and 3 more
    MJ1010-like_2nd; Uncharacterized ATP-binding protein MJ1010-like, C-terminal domain (PF21690; HMM-score: 14.4)
    NSUN_ferredox (CL0795) NSUN5_fdxn-like; NOL1/NOP2/Sun domain family member 5, ferredoxin-like domain (PF21148; HMM-score: 13.6)
    no clan defined F-protein; Negative factor, (F-Protein) or Nef (PF00469; HMM-score: 12.6)

Structure, modifications & cofactors[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8523
    • Cytoplasmic Membrane Score: 0.0001
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.1475
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002478
    • TAT(Tat/SPI): 0.000134
    • LIPO(Sec/SPII): 0.000435
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNTNDAIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENYPGISFDTIYRNLHLFKDLGIIENTELDGEMKFRIACTNHHHHHFICEKCGDTKVIDYCPIDQIKLSLPGVNIHKHKLEVYGVCESCQD

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3] [4]
  • quantitative data / protein copy number per cell: 242 [5]
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: Zur* (repression) regulon
    Zur*(TF)important in Zinc homeostasis; RegPrecise    transcription unit transferred from N315 data RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]