Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1457 [new locus tag: NWMN_RS08220 ]
- pan locus tag?: SAUPAN004135000
- symbol: NWMN_1457
- pan gene symbol?: zur
- synonym:
- product: zinc-specific metalloregulatory protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1457 [new locus tag: NWMN_RS08220 ]
- symbol: NWMN_1457
- product: zinc-specific metalloregulatory protein
- replicon: chromosome
- strand: -
- coordinates: 1624813..1625223
- length: 411
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332491 NCBI
- RefSeq: YP_001332491 NCBI
- BioCyc:
- MicrobesOnline: 3707009 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAATACAAATGATGCTATTAAAATTTTAAAAGAGAACGGTTTAAAATATACAGATAAA
CGTAAAGATATGTTAGATATTTTTGTCGAAGAAGATAAGTATATAAACGCAAAGTATATA
CAACAAGTTATGGATGAAAATTATCCTGGAATTTCATTCGACACAATATATAGAAACCTG
CACTTATTTAAAGATTTAGGAATTATTGAAAATACAGAACTTGATGGTGAAATGAAGTTT
AGAATCGCTTGTACAAACCATCATCATCATCATTTTATCTGTGAAAAGTGTGGAGATACA
AAGGTAATAGATTATTGTCCAATAGATCAGATAAAATTATCACTACCTGGTGTTAATATT
CACAAACACAAACTTGAAGTTTATGGTGTATGTGAGTCTTGCCAAGATTAA60
120
180
240
300
360
411
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1457 [new locus tag: NWMN_RS08220 ]
- symbol: NWMN_1457
- description: zinc-specific metalloregulatory protein
- length: 136
- theoretical pI: 6.07084
- theoretical MW: 15922.1
- GRAVY: -0.516912
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Zinc uptake regulation protein Zur
- PFAM: HTH (CL0123) FUR; Ferric uptake regulator family (PF01475; HMM-score: 114)and 3 moreMJ1010-like_2nd; Uncharacterized ATP-binding protein MJ1010-like, C-terminal domain (PF21690; HMM-score: 14.4)NSUN_ferredox (CL0795) NSUN5_fdxn-like; NOL1/NOP2/Sun domain family member 5, ferredoxin-like domain (PF21148; HMM-score: 13.6)no clan defined F-protein; Negative factor, (F-Protein) or Nef (PF00469; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effector: Zinc ion (Zn2+)
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8523
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0
- Extracellular Score: 0.1475
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002478
- TAT(Tat/SPI): 0.000134
- LIPO(Sec/SPII): 0.000435
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNTNDAIKILKENGLKYTDKRKDMLDIFVEEDKYINAKYIQQVMDENYPGISFDTIYRNLHLFKDLGIIENTELDGEMKFRIACTNHHHHHFICEKCGDTKVIDYCPIDQIKLSLPGVNIHKHKLEVYGVCESCQD
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: Zur* (repression) regulon
Zur* (TF) important in Zinc homeostasis; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]