Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1464 [new locus tag: SACOL_RS07470 ]
- pan locus tag?: SAUPAN003860000
- symbol: SACOL1464
- pan gene symbol?: brxA
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1464 [new locus tag: SACOL_RS07470 ]
- symbol: SACOL1464
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1475845..1476282
- length: 438
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238106 NCBI
- RefSeq: YP_186312 NCBI
- BioCyc: see SACOL_RS07470
- MicrobesOnline: 912920 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAATGCATATGATGCTTATATGAAAGAAATTGCGCAACAAATGCGTGGCGAATTAACT
CAAAATGGTTTTACAAGTTTAGAAACGAGCGAAGCAGTATCGGAGTATATGAACCAAGTA
AATGCTGATGACACTACTTTTGTAGTTATTAACTCTACATGCGGCTGTGCAGCTGGATTA
GCAAGACCAGCTGCAGTAGCAGTTGCAACACAAAATGAACATAGACCTACAAATACAGTT
ACAGTTTTTGCTGGGCAAGATAAAGAAGCAACTGCTACAATGCGAGAATTCATTCAGCAA
GCACCATCTAGTCCTTCGTATGCTTTATTCAAAGGTCAAGATTTAGTTTATTTTATGCCT
AGAGAATTTATCGAAGGTAGAGATATTAATGACATTGCAATGGACTTAAAGGATGCCTTT
GACGAAAATTGTAAATAG60
120
180
240
300
360
420
438
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1464 [new locus tag: SACOL_RS07470 ]
- symbol: SACOL1464
- description: hypothetical protein
- length: 145
- theoretical pI: 4.14983
- theoretical MW: 16013.8
- GRAVY: -0.362069
⊟Function[edit | edit source]
- TIGRFAM: putative bacilliredoxin, YphP/YqiW family (TIGR04191; EC 1.-.-.-; HMM-score: 181.9)
- TheSEED :
- UPF0403 protein YphP
- PFAM: no clan defined Disulph_isomer; Disulphide isomerase (PF06491; HMM-score: 179.6)and 2 moreLytR_C; LytR cell envelope-related transcriptional attenuator (PF13399; HMM-score: 16.8)THBO-biosyn (CL0334) GCHY-1; Type I GTP cyclohydrolase folE2 (PF02649; HMM-score: 13.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 0.67
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.061182
- TAT(Tat/SPI): 0.00298
- LIPO(Sec/SPII): 0.002073
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNAYDAYMKEIAQQMRGELTQNGFTSLETSEAVSEYMNQVNADDTTFVVINSTCGCAAGLARPAAVAVATQNEHRPTNTVTVFAGQDKEATATMREFIQQAPSSPSYALFKGQDLVYFMPREFIEGRDINDIAMDLKDAFDENCK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 13.61 h [6]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)