From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1371 [new locus tag: SA_RS07760 ]
  • pan locus tag?: SAUPAN004120000
  • symbol: SA1371
  • pan gene symbol?: comGD
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA1371 [new locus tag: SA_RS07760 ]
  • symbol: SA1371
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1578408..1578842
  • length: 435
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGCAAATTAGAAAGCAGTCAGCATTTACTATGATTGAGATGCTTGTGGTAATGATGTTA
    ATCAGTATATTTCTACTTTTGACAATGACATCTAAAGGATTAAGCAATCTTAGAGTAATA
    GATGATGAGGCAAATATCATTTCTTTTATTACTGAATTGAATTATATTAAGTCGCAAGCT
    ATAGCAAATCAAGGATATATCAATGTTAGATTTTATGAAAACAGTGACACTATTAAAGTA
    ATAGAGAATAATAAAATACGATTTCTAAAATTAAAAGTAGGCAAAATAATTAATGTTGCA
    AAAGTTGATATTATTGCCTTTGATAAAAAAGGGAATATCAATAAATTTGGTAGCATAACA
    ATTGACAATAACAATTCAATTTATAGAATAATATTCCATATTGAAAAAGGAAGAATTCGT
    TATGAAAAGCTATAA
    60
    120
    180
    240
    300
    360
    420
    435

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA1371 [new locus tag: SA_RS07760 ]
  • symbol: SA1371
  • description: hypothetical protein
  • length: 144
  • theoretical pI: 10.3612
  • theoretical MW: 16666.6
  • GRAVY: 0.13125

⊟Function[edit | edit source]

  • TIGRFAM:
    Cell structure Cell envelope Surface structures Verru_Chthon cassette protein D (TIGR02596; HMM-score: 29.2)
    Cell structure Cell envelope Surface structures prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 24.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 24.7)
    and 5 more
    Cellular processes Cellular processes Pathogenesis type II secretion system protein H (TIGR01708; HMM-score: 19.5)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type II secretion system protein H (TIGR01708; HMM-score: 19.5)
    Cell structure Cell envelope Surface structures type IV pilus modification protein PilV (TIGR02523; HMM-score: 13.3)
    Genetic information processing Protein fate Protein modification and repair type IV pilus modification protein PilV (TIGR02523; HMM-score: 13.3)
    Cell structure Cell envelope Surface structures Verru_Chthon cassette protein C (TIGR02599; HMM-score: 11.6)
  • TheSEED  :
    • Late competence protein ComGD, access of DNA to ComEA, FIG012777
    DNA Metabolism DNA uptake, competence Late competence  Late competence protein ComGD, access of DNA to ComEA, FIG012777
  • PFAM:
    no clan defined N_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 27.5)
    and 1 more
    Corona_RPol_N; Coronavirus RPol N-terminus (PF06478; HMM-score: 14.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.400751
    • TAT(Tat/SPI): 0.00726
    • LIPO(Sec/SPII): 0.04708
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYIKSQAIANQGYINVRFYENSDTIKVIENNKIRFLKLKVGKIINVAKVDIIAFDKKGNINKFGSITIDNNNSIYRIIFHIEKGRIRYEKL

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigH* regulon
    SigH*(sigma factor)controlling competence and phage integrase genes;  [1]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Kazuya Morikawa, Yumiko Inose, Hideyuki Okamura, Atsushi Maruyama, Hideo Hayashi, Kunio Takeyasu, Toshiko Ohta
    A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes.
    Genes Cells: 2003, 8(8);699-712
    [PubMed:12875655] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA1371&oldid=87352"