From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_001532
  • pan locus tag?: SAUPAN004120000
  • symbol: comGD
  • pan gene symbol?: comGD
  • synonym:
  • product: competence type IV pilus minor pilin ComGD

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_001532
  • symbol: comGD
  • product: competence type IV pilus minor pilin ComGD
  • replicon: chromosome
  • strand: -
  • coordinates: 1571339..1571785
  • length: 447
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGAGAAGCAGTTGCAAATTAGAAAGCAGTCAGCATTTACTATGATTGAGATGCTTGTG
    GTAATGATGTTAATCAGTATATTTCTACTTTTGACAATGACATCTAAAGGATTAAGCAAT
    CTTAGAGTAATAGATGATGAGGCAAATATCATTTCTTTTATTACTGAATTGAATTATATT
    AAGTCGCAAGCTATAGCAAATCAAGGATATATCAATGTTAGATTTTATGAAAACAGTGAC
    ACTATTAAAGTAATAGAGAATAATAAAATACGATTTCTAAAATTAAAAGTAGGCAAAATA
    ATTAATGTTGCAAAAGTTGATATTATTGCCTTTGATAAAAAAGGGAATATCAATAAATTT
    GGTAGCATAACAATTGACAATAACAATTCAATTTATAGAATAATATTCCATATTGAAAAA
    GGAAGAATTCGTTATGAAAAGCTATAA
    60
    120
    180
    240
    300
    360
    420
    447

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_001532
  • symbol: ComGD
  • description: competence type IV pilus minor pilin ComGD
  • length: 148
  • theoretical pI: 10.333
  • theoretical MW: 17165.2
  • GRAVY: 0.0797297

Function[edit | edit source]

  • TIGRFAM:
    Cell structure Cell envelope Surface structures Verru_Chthon cassette protein D (TIGR02596; HMM-score: 29.1)
    Cell structure Cell envelope Surface structures prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 24.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 24.6)
    and 5 more
    Cellular processes Cellular processes Pathogenesis type II secretion system protein H (TIGR01708; HMM-score: 19.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type II secretion system protein H (TIGR01708; HMM-score: 19.4)
    Cell structure Cell envelope Surface structures type IV pilus modification protein PilV (TIGR02523; HMM-score: 13.2)
    Genetic information processing Protein fate Protein modification and repair type IV pilus modification protein PilV (TIGR02523; HMM-score: 13.2)
    Cell structure Cell envelope Surface structures Verru_Chthon cassette protein C (TIGR02599; HMM-score: 11.5)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined N_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 28.1)
    and 2 more
    CoV_RPol_N; Coronavirus RNA-dependent RNA polymerase, N-terminal (PF06478; HMM-score: 14.8)
    Plasmid_toxin (CL0136) HigB-like_toxin; RelE-like toxin of type II toxin-antitoxin system HigB (PF05015; HMM-score: 13.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9782
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0218
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.275053
    • TAT(Tat/SPI): 0.006525
    • LIPO(Sec/SPII): 0.036629
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MEKQLQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYIKSQAIANQGYINVRFYENSDTIKVIENNKIRFLKLKVGKIINVAKVDIIAFDKKGNINKFGSITIDNNNSIYRIIFHIEKGRIRYEKL

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigH* regulon
    SigH*(sigma factor)controlling competence and phage integrase genes;  [2]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. Kazuya Morikawa, Yumiko Inose, Hideyuki Okamura, Atsushi Maruyama, Hideo Hayashi, Kunio Takeyasu, Toshiko Ohta
    A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes.
    Genes Cells: 2003, 8(8);699-712
    [PubMed:12875655] [WorldCat.org] [DOI] (P p)

Relevant publications[edit | edit source]