Jump to navigation
		Jump to search
		
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1501 [new locus tag: SAUSA300_RS08200 ]
- pan locus tag?: SAUPAN004120000
- symbol: SAUSA300_1501
- pan gene symbol?: comGD
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1501 [new locus tag: SAUSA300_RS08200 ]
- symbol: SAUSA300_1501
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1654322..1654768
- length: 447
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914339 NCBI
- RefSeq: YP_494196 NCBI
- BioCyc: see SAUSA300_RS08200
- MicrobesOnline: 1293016 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241
 301
 361
 421ATGGAGAAGCAGTTGCAAATTAGAAAGCAGTCAGCATTTACTATGATTGAGATGCTTGTG
 GTAATGATGTTAATCAGTATATTTCTACTTTTGACAATGACATCTAAAGGATTAAGCAAT
 CTTAGAGTAATAGATGATGAGGCAAATATCATTTCTTTTATTACTGAATTGAATTATATT
 AAGTCGCAAGCTATAGCAAATCAAGGATATATCAATGTTAGATTTTATGAAAACAGTGAC
 ACTATTAAAGTAATAGAGAATAATAATATACGATTTCTAAAATTAAAAGTAGGCAAAATA
 ATTAATGTTGCAAAAGTTGATATTATTGCCTTTGATAAAAAAGGGAATATCAATAAATTT
 GGTAGCATAACAATTTACAATAACAATTCAATTTATAGAATAATATTCCATATTGAAAAA
 GGAAGAATTCGTTATGAAAAGCTATAA60
 120
 180
 240
 300
 360
 420
 447
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1501 [new locus tag: SAUSA300_RS08200 ]
- symbol: SAUSA300_1501
- description: hypothetical protein
- length: 148
- theoretical pI: 10.2928
- theoretical MW: 17199.2
- GRAVY: 0.0972973
⊟Function[edit | edit source]
- TIGRFAM: Cell envelope Surface structures Verru_Chthon cassette protein D (TIGR02596; HMM-score: 29.2)Cell envelope Surface structures prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 24.6)Protein fate Protein and peptide secretion and trafficking prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 24.6)and 5 moreCellular processes Pathogenesis type II secretion system protein H (TIGR01708; HMM-score: 19.3)Protein fate Protein and peptide secretion and trafficking type II secretion system protein H (TIGR01708; HMM-score: 19.3)Cell envelope Surface structures type IV pilus modification protein PilV (TIGR02523; HMM-score: 13)Protein fate Protein modification and repair type IV pilus modification protein PilV (TIGR02523; HMM-score: 13)Cell envelope Surface structures Verru_Chthon cassette protein C (TIGR02599; HMM-score: 11.5)
- TheSEED  : - Late competence protein ComGD, access of DNA to ComEA, FIG012777
 
- PFAM: no clan defined N_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 28.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
 
- DeepLocPro: Cytoplasmic Membrane- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9697
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0302
 
- LocateP: N-terminally anchored (No CS) - Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
 
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.275053
- TAT(Tat/SPI): 0.006525
- LIPO(Sec/SPII): 0.036629
 
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEKQLQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYIKSQAIANQGYINVRFYENSDTIKVIENNNIRFLKLKVGKIINVAKVDIIAFDKKGNINKFGSITIYNNNSIYRIIFHIEKGRIRYEKL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]