PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

⊟Summary

• organism: Staphylococcus aureus N315
• locus tag: SA1372 [new locus tag: SA_RS07765 ]
• pan locus tag^?: SAUPAN004121000
• symbol: SA1372
• pan gene symbol^?: comGC
• synonym:
• product: exogenous DNA-binding protein comGC

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SA1372 [new locus tag: SA_RS07765 ]
• symbol: SA1372
• product: exogenous DNA-binding protein comGC
• replicon: chromosome
• strand: -
• coordinates: 1578832..1579143
• length: 312
• essential: no DEG other strains

⊟Accession numbers

• Gene ID: 1124212 NCBI
• RefSeq: NP_374655 NCBI
• BioCyc: see SA_RS07765
• MicrobesOnline: 103681 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  
  ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTA
  TTAATCATCAGTTTATTATTAATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCAC
  ATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTAATAGTCAAATTGAAGCGTAT
  GCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
  AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCA
  GTTGCAAATTAG
  60
  120
  180
  240
  300
  312
  

⊟Protein

⊟General

• locus tag: SA1372 [new locus tag: SA_RS07765 ]
• symbol: SA1372
• description: exogenous DNA-binding protein comGC
• length: 103
• theoretical pI: 8.76209
• theoretical MW: 11315.3
• GRAVY: 0.283495

⊟Function

• TIGRFAM:
  Cellular processes Cellular processes Pathogenesis type II secretion system protein G (TIGR01710; HMM-score: 41.8)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type II secretion system protein G (TIGR01710; HMM-score: 41.8)
  and 7 more
  Cell structure Cell envelope Surface structures Verru_Chthon cassette protein D (TIGR02596; HMM-score: 24.9)
  Cellular processes Cellular processes Pathogenesis type II secretion system protein H (TIGR01708; HMM-score: 20.2)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type II secretion system protein H (TIGR01708; HMM-score: 20.2)
  Cell structure Cell envelope Surface structures prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 20.1)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 20.1)
  Cell structure Cell envelope Surface structures Verru_Chthon cassette protein C (TIGR02599; HMM-score: 16.7)
  type II secretion system protein I (TIGR01707; HMM-score: 11.5)
• TheSEED  :
  • Late competence protein ComGC, access of DNA to ComEA, FIG007487
  DNA Metabolism DNA uptake, competence Late competence  Late competence protein ComGC, access of DNA to ComEA, FIG007487
• PFAM:
  no clan defined N_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 23.8)
  and 6 more
  SecD-TM1; SecD export protein N-terminal TM region (PF13721; HMM-score: 15)
  HTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 14.2)
  no clan defined SHP; Small hydrophobic protein (PF03579; HMM-score: 13.5)
  Ecm33; GPI-anchored cell wall organization protein (PF12454; HMM-score: 11.4)
  Tad-like (CL0496) TadF; Putative tight adherence pilin protein F (PF16964; HMM-score: 10.2)
  no clan defined DUF5383; Family of unknown function (DUF5383) (PF17355; HMM-score: 7.8)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Cellwall
  • Cytoplasmic Score: 0.11
  • Cytoplasmic Membrane Score: 0.93
  • Cellwall Score: 8.19
  • Extracellular Score: 0.77
  • Internal Helix: 1
• LocateP: N-terminally anchored (No CS)
  • Prediction by SwissProt Classification: Membrane
  • Pathway Prediction: Sec-(SPI)
  • Intracellular possibility: 0.17
  • Signal peptide possibility: 0.5
  • N-terminally Anchored Score: 7
  • Predicted Cleavage Site: No CleavageSite
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.25928
  • TAT(Tat/SPI): 0.002582
  • LIPO(Sec/SPII): 0.008511
• predicted transmembrane helices (TMHMM): 1

⊟Accession numbers

• GI: 15927122 NCBI
• RefSeq: NP_374655 NCBI
• UniProt: A0A0H3JMR8 UniProt

⊟Protein sequence

• MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFIKEAQKTCKSGETITISNGEAVAN

⊟Experimental data

• experimentally validated: data available for NCTC8325
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: SA1369 < SA1370 < SA1371 < SA1372 < SA1373 < SA1374 < SA1375 < SA1376 < glcK < SA1378 < SA1379 < SA1380

⊟Regulation

• regulator: SigH* regulon

  SigH*

  (sigma factor)

  controlling competence and phage integrase genes;

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications