From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0322 [new locus tag: SA_RS01850 ]
  • pan locus tag?: SAUPAN001868000
  • symbol: SA0322
  • pan gene symbol?: mepR
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0322 [new locus tag: SA_RS01850 ]
  • symbol: SA0322
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 379975..380394
  • length: 420
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGAATTCACTTATTCGTATTTATTTAGAATGATTAGTCATGAGATGAAACAAAAGGCT
    GATCAAAAGTTAGAGCAATTTGATATTACAAATGAGCAAGGTCATACGTTAGGTTATCTT
    TATGCACATCAACAAGATGGACTGACACAAAATGATATTGCTAAAGCATTACAACGAACA
    GGTCCAACTGTCAGTAATTTATTAAGGAACCTTGAACGTAAAAAGCTGATCTATCGCTAT
    GTCGATGCACAAGATACGAGAAGAAAGAATATAGGACTGACTACCTCTGGGATTAAACTT
    GTAGAAGCATTCACTTCGATATTTGATGAAATGGAGCAAACACTCGTATCGCAGTTATCT
    GAAGAAGAAAATGAACAAATGAAAGCAAACTTAACTAAAATGTTATCTAGTTTACAATAA
    60
    120
    180
    240
    300
    360
    420

Protein[edit | edit source]

Protein Data Bank: 5F6F
Protein Data Bank: 5FFX

General[edit | edit source]

  • locus tag: SA0322 [new locus tag: SA_RS01850 ]
  • symbol: SA0322
  • description: hypothetical protein
  • length: 139
  • theoretical pI: 6.26722
  • theoretical MW: 16172.2
  • GRAVY: -0.669784

Function[edit | edit source]

  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 40.9)
    and 5 more
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 30)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 22.8)
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 20.4)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 13.8)
    Signal transduction Regulatory functions DNA interactions aminoethylphosphonate catabolism associated LysR family transcriptional regulator (TIGR03339; HMM-score: 13.6)
  • TheSEED  :
    • Transcriptional regulator, MarR family
  • PFAM:
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 47.5)
    and 25 more
    MarR; MarR family (PF01047; HMM-score: 37.6)
    Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 29.7)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 21.9)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 21.6)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 19.8)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 19.4)
    HTH_69; Winged helix-turn-helix domain (PF22979; HMM-score: 19.3)
    HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 17.2)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 17.2)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 17.2)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.1)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 15.1)
    DUF6293_C; DUF6293 C-terminal winged helix domain (PF22665; HMM-score: 15)
    Crp; Bacterial regulatory proteins, crp family (PF00325; HMM-score: 14.7)
    no clan defined DUF445; Protein of unknown function (DUF445) (PF04286; HMM-score: 14.7)
    HTH (CL0123) Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 14.4)
    Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 14.3)
    DUF1670; Protein of unknown function (DUF1670) (PF07900; HMM-score: 14.3)
    B-block_TFIIIC; B-block binding subunit of TFIIIC (PF04182; HMM-score: 13.5)
    AAA_lid (CL0671) Vps4_C; Vps4 C terminal oligomerisation domain (PF09336; HMM-score: 13.5)
    HTH (CL0123) HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 13.5)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 13.1)
    no clan defined DUF6664; Family of unknown function (DUF6664) (PF20369; HMM-score: 13)
    HTH (CL0123) HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.4)
    HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 12.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors: Bis-indoles; Distamycin
  • genes regulated by MepR*, TF important in Multidrug resistanceRegPrecise
    repression

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9936
    • Cytoplasmic Membrane Score: 0.0038
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0022
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005476
    • TAT(Tat/SPI): 0.000487
    • LIPO(Sec/SPII): 0.000763
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: MepR* (repression) regulon
    MepR*(TF)important in Multidrug resistance; RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]