From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS11005 [old locus tag: NWMN_1909 ]
  • pan locus tag?: SAUPAN005101000
  • symbol: NWMN_RS11005
  • pan gene symbol?: ssb
  • synonym:
  • product: single-stranded DNA-binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS11005 [old locus tag: NWMN_1909 ]
  • symbol: NWMN_RS11005
  • product: single-stranded DNA-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2119874..2120344
  • length: 471
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (2119874..2120344) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1909

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACT
    CAAAGTGGTGTAAATGTAGCATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCA
    CAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTATTTAAAAAACAAGCAGAGAAC
    GTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
    AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATT
    CAATTTTTAGAACCGAAGAACTCAAATGACACTCAACAAGATTTATATCAACAACAAGTA
    CAACAAACACGTGGACAATCGCAATATTCAAATAACAAACCAGTAAAAGATAATCCGTTT
    GCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
    60
    120
    180
    240
    300
    360
    420
    471

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS11005 [old locus tag: NWMN_1909 ]
  • symbol: NWMN_RS11005
  • description: single-stranded DNA-binding protein
  • length: 156
  • theoretical pI: 5.26974
  • theoretical MW: 17627.4
  • GRAVY: -0.792308

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair single-stranded DNA-binding protein (TIGR00621; HMM-score: 153)
    and 1 more
    Genetic information processing DNA metabolism DNA replication, recombination, and repair primosomal replication protein PriB (TIGR04418; HMM-score: 27)
  • TheSEED: see NWMN_1909
  • PFAM:
    OB (CL0021) SSB; Single-strand binding protein family (PF00436; HMM-score: 129.7)
    and 3 more
    SSB_1; Another single-strand binding protein family (PF22657; HMM-score: 23.7)
    tRNA_anti-codon; OB-fold nucleic acid binding domain (PF01336; HMM-score: 19.3)
    no clan defined DUF6535; Family of unknown function (DUF6535) (PF20153; HMM-score: 13.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9196
    • Cytoplasmic Membrane Score: 0.0021
    • Cell wall & surface Score: 0.0011
    • Extracellular Score: 0.0772
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.035423
    • TAT(Tat/SPI): 0.008821
    • LIPO(Sec/SPII): 0.004455
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:
    NWMN_RS00315peptidoglycan-binding protein LysM  [1] (data from MRSA252)
    NWMN_RS0291550S ribosomal protein L1  [1] (data from MRSA252)
    NWMN_RS02960elongation factor G  [1] (data from MRSA252)
    NWMN_RS02965elongation factor Tu  [1] (data from MRSA252)
    NWMN_RS04195aldehyde dehydrogenase  [1] (data from MRSA252)
    NWMN_RS05380pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    NWMN_RS05390dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    NWMN_RS05395dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    NWMN_RS06585elongation factor Ts  [1] (data from MRSA252)
    NWMN_RS07455dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex  [1] (data from MRSA252)
    NWMN_RS1226030S ribosomal protein S9  [1] (data from MRSA252)

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]