From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1792 [new locus tag: SA_RS10295 ]
  • pan locus tag?: SAUPAN005101000
  • symbol: SA1792
  • pan gene symbol?: ssb
  • synonym:
  • product: single-strand DNA-binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1792 [new locus tag: SA_RS10295 ]
  • symbol: SA1792
  • product: single-strand DNA-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2036848..2037318
  • length: 471
  • essential: yes DEG

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACT
    CAAAGTGGTGTAAATGTAGCATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCA
    CAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTATTTAAAAAACAAGCAGAGAAC
    GTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
    AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATT
    CAATTTTTAGAACCGAAAAACTCAAATGACACTCAACAAGATTTATATCAACAACAAGTA
    CAACAAACACGTGGACAATCGCAATATTCAAATAACAAACCAGTAAAAGATAATCCGTTT
    GCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
    60
    120
    180
    240
    300
    360
    420
    471

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1792 [new locus tag: SA_RS10295 ]
  • symbol: SA1792
  • description: single-strand DNA-binding protein
  • length: 156
  • theoretical pI: 5.26974
  • theoretical MW: 17641.4
  • GRAVY: -0.785897

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair single-stranded DNA-binding protein (TIGR00621; HMM-score: 153.2)
    and 1 more
    Genetic information processing DNA metabolism DNA replication, recombination, and repair primosomal replication protein PriB (TIGR04418; HMM-score: 27.1)
  • TheSEED  :
    • Phage ssDNA binding protein
    DNA Metabolism DNA repair DNA repair, bacterial  Single-stranded DNA-binding protein
    and 1 more
    DNA Metabolism DNA repair DNA repair, bacterial RecFOR pathway  Single-stranded DNA-binding protein
  • PFAM:
    OB (CL0021) SSB; Single-strand binding protein family (PF00436; HMM-score: 126.5)
    and 1 more
    tRNA_anti-codon; OB-fold nucleic acid binding domain (PF01336; HMM-score: 18.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.035423
    • TAT(Tat/SPI): 0.008821
    • LIPO(Sec/SPII): 0.004455
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:
    SA0505(fus)elongation factor G  [1] (data from MRSA252)
    SA0727(gap)glyceraldehyde-3-phosphate dehydrogenase  [1] (data from MRSA252)
    SA1244(odhB)dihydrolipoamide succinyltransferase  [1] (data from MRSA252)
    SA0943-1(pdhA)pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA0945(pdhC)branched-chain alpha-keto acid dehydrogenase E2 subunit  [1] (data from MRSA252)
    SA0946(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    SA0496(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    SA2016(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    SA0107(spa)immunoglobulin G binding protein A  [1] (data from MRSA252)
    SA1100(tsf)elongation factor Ts  [1] (data from MRSA252)
    SA0506(tuf)elongation factor Tu  [1] (data from MRSA252)

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]