From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_002201
  • pan locus tag?: SAUPAN005689000
  • symbol: JSNZ_002201
  • pan gene symbol?: rpsN
  • synonym:
  • product: type Z 30S ribosomal protein S14

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_002201
  • symbol: JSNZ_002201
  • product: type Z 30S ribosomal protein S14
  • replicon: chromosome
  • strand: -
  • coordinates: 2209418..2209603
  • length: 186
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    GTGGCTAAAACTTCAATGGTTGCTAAGCAACAAAAAAAACAAAAATATGCAGTTCGTGAA
    TACACTCGTTGTGAACGTTGTGGCCGTCCACATTCTGTATATCGTAAATTTAAATTATGC
    CGTATTTGTTTCCGTGAATTAGCTTACAAAGGCCAAATCCCTGGCGTTCGTAAAGCTAGC
    TGGTAA
    60
    120
    180
    186

Protein[edit | edit source]

Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: JSNZ_002201
  • symbol: JSNZ_002201
  • description: type Z 30S ribosomal protein S14
  • length: 61
  • theoretical pI: 10.9538
  • theoretical MW: 7299.67
  • GRAVY: -0.840984

Function[edit | edit source]

  • TIGRFAM:
    Hypothetical proteins Conserved TIGR00269 family protein (TIGR00269; HMM-score: 14.4)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    Tbcl_zf (CL0839) Ribosomal_S14; Ribosomal protein S14p/S29e (PF00253; HMM-score: 88.4)
    and 3 more
    Zn_Beta_Ribbon (CL0167) DZR_2; Double zinc ribbon domain (PF18912; HMM-score: 15.8)
    no clan defined DUF6011; Family of unknown function (DUF6011) (PF19474; HMM-score: 13.6)
    C2H2-zf (CL0361) zf_C2H2_13; Zinc Finger domain (PF18508; HMM-score: 7.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.4801
    • Cytoplasmic Membrane Score: 0.0015
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.5184
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.065025
    • TAT(Tat/SPI): 0.015035
    • LIPO(Sec/SPII): 0.00934
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MAKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]