Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_002203
- pan locus tag?: SAUPAN005691000
- symbol: rplX
- pan gene symbol?: rplX
- synonym:
- product: 50S ribosomal protein L24
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_002203
- symbol: rplX
- product: 50S ribosomal protein L24
- replicon: chromosome
- strand: -
- coordinates: 2210192..2210509
- length: 318
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCATATCAAAAAAGGTGACAACGTTAAAGTTATCGCAGGTAAAGACAAAGGTAAAGAA
GGTAAAGTAATTGCTACTCTACCTAAAAAAGACCGTGTCGTTGTGGAAGGTGTTAACATT
ATGAAAAAACACCAAAAACCAACTCAATTAAATCCTGAAGGTGGAATCTTAGAAACAGAG
GCAGCAATCCATGTTTCTAATGTACAATTATTGGACCCTAAAACAAACGAACCAACTCGT
GTAGGTTACAAATTTGTTGATGGTAAAAAAGTTCGTATCGCTAAAAAATCTGGCGAAGAA
ATTAAATCTAATAATTAA60
120
180
240
300
318
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: JSNZ_002203
- symbol: RplX
- description: 50S ribosomal protein L24
- length: 105
- theoretical pI: 10.5873
- theoretical MW: 11536.4
- GRAVY: -0.722857
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL24 (TIGR01079; HMM-score: 136.5)and 3 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL24 (TIGR01080; HMM-score: 32.2)transcription elongation factor Spt5 (TIGR00405; HMM-score: 17.5)HAD phosphatase, family IIIB (TIGR01672; EC 3.1.3.-; HMM-score: 13.1)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: SH3 (CL0010) ribosomal_L24; Ribosomal proteins 50S L24/mitochondrial 39S L24 (PF17136; HMM-score: 106)and 6 moreKOW; KOW motif (PF00467; HMM-score: 37.5)KOW7_SPT5; Transcription elongation factor SPT5, seventh KOW domain (PF23287; HMM-score: 19.5)KOW4_SPT5; Transcription elongation factor SPT5, fourth KOW domain (PF23291; HMM-score: 19)Ribosomal_uL24m-like; Large ribosomal subunit protein uL24m (PF22682; HMM-score: 18.5)no clan defined SPP1_Dit; Siphovirus-type tail component, C-terminal domain (PF22768; HMM-score: 15.3)SH3 (CL0010) KOW2_Spt5; Transcription elongation factor SPT5, second KOW domain (PF23284; HMM-score: 11.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9348
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0649
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008389
- TAT(Tat/SPI): 0.000477
- LIPO(Sec/SPII): 0.002161
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MHIKKGDNVKVIAGKDKGKEGKVIATLPKKDRVVVEGVNIMKKHQKPTQLNPEGGILETEAAIHVSNVQLLDPKTNEPTRVGYKFVDGKKVRIAKKSGEEIKSNN
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)