⊟Summary[edit | edit source]
- pan ID?: SAUPAN005689000
- symbol?: rpsN
- synonym:
- description?: 30S ribosomal protein S14
- 30S ribosomal protein S14
- 30S ribosomal protein S14 type Z
- type Z 30S ribosomal protein S14
- ribosomal protein S14p/S29e
- ribosomal protein S14p/S29e family protein
descriptions from strain specific annotations:
- strand?: -
- coordinates?: 5804724..5804894
- synteny block?: BlockID0044350
- occurrence?: in 97% of 34 strains
rpsN : 30S ribosomal protein S14 type Z [1]
• two crystal structures are available : 6YEF , 8BH6
Staphylococci have two copies of rpsN. rpsN is the bona fide "type Z" version found in a large operon of ribosomal proteins while rpsN2 is next to the gene encoding guanosine monophosphate reductase and lacks the canonical CXXC zinc binding motif required for a functional 30S ribosome. Considering the low full-length identity, dissimilar N-termini, the loss of zinc binding motifs and the essentiality of rpsN (but not rpsN2), it is unclear if rpsN2 still performs any analogous function to "type Z" ribosomal rpsN. Staphylococcal 30S ribosomal protein S14 type Z is also known as "uS14" by the universal ribosomal protein nomenclature harmonization system. [2]
⊟Orthologs[edit | edit source]
⊟Genome Viewer[edit | edit source]
| COL | |
| N315 | |
| NCTC8325 | |
| Newman | |
| USA300_FPR3757 | |
| JSNZ |
⊟Alignments[edit | edit source]
- alignment of orthologues: CLUSTAL format alignment by MAFFT L-INS-i (v7.505)
COL MAKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKAS
N315 MAKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKAS
NCTC8325 MAKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKAS
Newman MAKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKAS
USA300_FPR3757 MAKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKAS
JSNZ MAKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKAS
************************************************************
COL W
N315 W
NCTC8325 W
Newman W
USA300_FPR3757 W
JSNZ W
*
- ↑ Alexander Golubev, Bulat Fatkhullin, Iskander Khusainov, Lasse Jenner, Azat Gabdulkhakov, Shamil Validov, Gulnara Yusupova, Marat Yusupov, Konstantin Usachev
Cryo-EM structure of the ribosome functional complex of the human pathogen Staphylococcus aureus at 3.2 Å resolution.
FEBS Lett: 2020, 594(21);3551-3567
[PubMed:32852796] [WorldCat.org] [DOI] (I p) - ↑ Nenad Ban, Roland Beckmann, Jamie H D Cate, Jonathan D Dinman, François Dragon, Steven R Ellis, Denis L J Lafontaine, Lasse Lindahl, Anders Liljas, Jeffrey M Lipton, Michael A McAlear, Peter B Moore, Harry F Noller, Joaquin Ortega, Vikram Govind Panse, V Ramakrishnan, Christian M T Spahn, Thomas A Steitz, Marek Tchorzewski, David Tollervey, Alan J Warren, James R Williamson, Daniel Wilson, Ada Yonath, Marat Yusupov
A new system for naming ribosomal proteins.
Curr Opin Struct Biol: 2014, 24;165-9
[PubMed:24524803] [WorldCat.org] [DOI] (I p)