From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_002154
  • pan locus tag?: SAUPAN005580000
  • symbol: amaP
  • pan gene symbol?: amaP
  • synonym:
  • product: alkaline shock response membrane anchor protein AmaP

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_002154
  • symbol: amaP
  • product: alkaline shock response membrane anchor protein AmaP
  • replicon: chromosome
  • strand: -
  • coordinates: 2171204..2171740
  • length: 537
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    GTGAAACGACTTAAAAACTTTATCCTTGGCTTATTAATAGTAGTAATCGTGGGGTTCCTG
    TTATTCATGTATATCCAAGATGGACGTATAACTGAATATCAAGACTACTTCCTTCAATTT
    GAATGGTTCCAACCATTACTTATTTCACTTGCTGCACTATTGATATTAATAGGTCTTATA
    TTAGTATTTAGTATCTTCAAACCTACGCATCGAAAACCTGGATTATACAAAGACTTCGAT
    GATGGTCATGTTTACGTATCTCGTAAAGCTGTTGAAAAGACGGCATTCGATACGGTTGCA
    AAATATGATCAAGTAAGACAACCAAATGTAGTTGCGAAACTATATAACAAAAAAAATAAA
    TCTTATATCGACATTAAAACTGACTTTTTCGTACCAAATAATGTTCAAGTTCAATCTTTA
    ACTGAAGCAATTCGTTCTGATATTAAAAAGAATGTAGAATATTTCACAGAAATGCCAGTA
    CGTAAGTTAGAAGTTAATGTGAGAGATCAGAAAACTTCTGGTCCACGAGTGTTGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    537

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_002154
  • symbol: AmaP
  • description: alkaline shock response membrane anchor protein AmaP
  • length: 178
  • theoretical pI: 10.0687
  • theoretical MW: 20800.3
  • GRAVY:

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined Asp23; Asp23 family, cell envelope-related function (PF03780; HMM-score: 19.8)
    and 7 more
    DUF6057; Family of unknown function (DUF6057) (PF19529; HMM-score: 15.4)
    DUF3098; Protein of unknown function (DUF3098) (PF11297; HMM-score: 14.4)
    LysE (CL0292) SfLAP; Sap, sulfolipid-1-addressing protein (PF11139; HMM-score: 14.1)
    BPD_transp_1 (CL0404) FtsX; FtsX-like permease C-terminal (PF02687; HMM-score: 11.8)
    no clan defined DUF997; Protein of unknown function (DUF997) (PF06196; HMM-score: 10.5)
    FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 10.1)
    FtsH_ext; FtsH Extracellular (PF06480; HMM-score: 8.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9921
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0078
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007807
    • TAT(Tat/SPI): 0.000163
    • LIPO(Sec/SPII): 0.045242
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MKRLKNFILGLLIVVIVGFLLFMYIQDGRITEYQDYFLQFEWFQPLLISLAALLILIGLILVFSIFKPTHRKPGLYKDFDDGHVYVSRKAVEKTAFDTVAKYDQVRQPNVVAKLYNKKNKSYIDIKTDFFVPNNVQVQSLTEAIRSDIKKNVEYFTEMPVRKLEVNVRDQKTSGPRVL

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB (activation) regulon
    SigB(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [2] [3] [4]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  3. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  4. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

Marret Müller, Swantje Reiß, Rabea Schlüter, Ulrike Mäder, Anica Beyer, Wenke Reiß, Jon Marles-Wright, Richard J Lewis, Henrike Pförtner, Uwe Völker, Katharina Riedel, Michael Hecker, Susanne Engelmann, Jan Pané-Farré
Deletion of membrane-associated Asp23 leads to upregulation of cell wall stress genes in Staphylococcus aureus.
Mol Microbiol: 2014, 93(6);1259-68
[PubMed:25074408] [WorldCat.org] [DOI] (I p)